KEGG   Caenorhabditis elegans (nematode): CELE_DH11.1Help
Entry
CELE_DH11.1       CDS       T00019                                 

Gene name
glna-2
Definition
Protein GLNA-2
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_DH11.1 (glna-2)
   00330 Arginine and proline metabolism
    CELE_DH11.1 (glna-2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CELE_DH11.1 (glna-2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CELE_DH11.1 (glna-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(8008683..8008743,8008946..8009121,8009168..8009316,8009361..8009571,8009754..8009916,8010045..8010277,8010337..8010552,8010596..8010727,8010778..8011155,8011302..8011400)
Genome map
AA seq 605 aa AA seqDB search
MTSKPTTQKSVMYRIPSERTLESLHEMIGSRMSKMSLKNTLRGISNPYERDENEGSEDMI
FELFKIPNKNEASIGKLLTVLRQLGLRDDDPRLVPMMEKIKDFEKIAEEKCSEATEQKHW
KLTKEQFKECIAPSIDIVSRALQTDMVIPNWVTFVDQIRTLFNECKEIREGQVATYIPQL
ARQSPNLWAVSLCTVDGQRASFGDVKHPFCVQSVSKAFNYAIVASDLGADVVHSYVGQEP
SGRLFNEICLDSTNKPHNPMVNSGAIVITSLIKSKTNMADRFDFVLNQYRKIAGNEFIGF
NNATFLSERATADRNYALSYFMKENRCFPKETESLTDALDFYFQLCSVEVTCESLAVMAS
TLANGGVCPITNETCVDPNPCRDVLSLMYSCGMYDASGQFSFNVGLPAKSGVSGAMIVVV
PNVMGICLFSPPLDSLGNSCRGVAFCKKLVSTFNFHNYDCLVHNSNIKSDPRRRDIRERD
RLIPVFHVARAGDLPTMRRLYMQGEDLNTSDHDDRTVLHIAATEGYETMIKFLVNVAKVD
VDKKDRWGRTPLDEAKFFKHDHVSRFLEKAMKRPEQHRKDSVSSLDTDDEIDDDGFPEKP
SFTID
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagcccacaactcaaaaaagtgtcatgtatcggataccttcagagcgaact
ttggaaagtctccatgagatgatcggatctcgaatgtcaaaaatgtcactaaagaatact
ttacgtggaatctcgaatccatacgaaagggatgaaaatgagggaagtgaggacatgatt
ttcgaattattcaaaattccaaacaagaatgaagcttcaattggaaagttactgacagtt
cttcgtcaattgggtcttagagatgatgatccacgacttgtaccaatgatggaaaaaata
aaagatttcgagaaaattgcagaagaaaaatgctcagaggcaaccgaacaaaaacattgg
aaactcaccaaagagcaattcaaagaatgcatagctccaagtattgatattgtatcacga
gctcttcaaactgatatggttattccaaattgggtcacttttgttgatcaaatacgtact
ttattcaatgaatgtaaagagattcgagaagggcaagttgccacatacattccacaattg
gcaagacaatctcctaatctttgggctgtttcattgtgcactgttgatggtcaaagggca
tcatttggagatgtgaagcatcctttctgtgtgcaatctgtatcaaaagcatttaattat
gcaattgttgcatctgatcttggtgcagatgtagttcattcttatgttgggcaggagcca
agtggaagactattcaatgaaatatgtctggattcaacaaacaaaccacacaaccctatg
gtaaattctggagcaattgtgatcacttcattgataaaaagcaaaaccaatatggcggat
cggtttgattttgtgcttaatcagtacagaaagattgctggaaatgaattcattgggttc
aacaatgccacatttttgtctgaaagagcaactgctgacagaaattacgcgttgtcatat
ttcatgaaagagaacagatgttttcccaaagagacagaatctctaacagatgcactcgat
ttctacttccaattgtgttcagttgaagtgacttgtgaatcacttgcagtaatggcttca
actcttgcaaatggtggagtgtgtccaatcactaatgagacatgcgtagatccaaatcca
tgtcgtgatgttttatcattaatgtattcatgtggaatgtacgatgcatctggacaattt
tcatttaatgtcgggttgccagctaaatcaggagtatctggtgcaatgatagtggtggtg
cctaatgtaatgggtatttgtctattttccccaccactggattcacttggtaacagttgt
agaggtgttgcattctgcaagaaactggtttccactttcaactttcacaattatgactgt
cttgttcataactccaatattaaaagtgatccaagaagaagagacattcgagagcgtgat
cgattaatccctgttttccacgtggcaagagctggggatctcccaacaatgagaagattg
tatatgcaaggagaagatttgaatacctctgatcacgatgatagaacagtcttgcatatt
gcagctactgaaggatatgagacaatgatcaaattcctggttaatgtggcaaaggttgat
gtggataagaaagatcgttggggacggactccgttggatgaagctaaattctttaaacat
gaccatgtttctagatttttagaaaaagcaatgaaacggccagagcaacacagaaaagat
tcagtttcttcattggatacagacgatgagattgatgatgatggttttccagagaagcct
tcttttacaattgattag

DBGET integrated database retrieval system