KEGG   Caenorhabditis elegans (nematode): CELE_E01B7.1Help
Entry
CELE_E01B7.1      CDS       T00019                                 

Gene name
E01B7.1
Definition
Protein E01B7.1
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cel00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CELE_E01B7.1 (E01B7.1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CELE_E01B7.1 (E01B7.1)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_E01B7.1 (E01B7.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(17925013..17925116,17925380..17925524,17925967..17926047,17926572..17926762,17927121..17927204,17927256..17927427,17928050..17928496,17928556..17928653,17929621..17929780,17930087..17930260,17930552..17930659,17931205..17931324,17931398..17931541,17932188..17932283,17932450..17932602,17933506..17933625,17934017..17934055)
Genome map
AA seq 811 aa AA seqDB search
MNSSGLQFTSMTELLATCSLTEQQTRQFEQKSLDVVYQSLKNLQGSAEKARGDLEQQYRL
LMKAGELGNIITKSSKFARWKQNTANAALFYADFEKVVREASNLQSVLNIKYENLVRRAD
TQKRAEQEAADKRAATITVDSTMRAVRAKITPRELVRKVENDTPKKSALIFDIRQNQSDA
IFYNRSEMITVIQVPYDMIDSSLTFASFRTNLAVTQRALLARLSTSDYVVLMDDDGPELV
NTSPLPKSKMSFLFKALTQYNQSERLRERPMFMEGGFKMWKAQYPTYTKNEQPVTPRSIP
SDELDDVISAYHRNYPMISEIRYPDLNTMRPEPTAQTPPAPAAPPAAPALNRQSTIPPVA
MTQRPMIPPSLPSSTPPAPLKPVAPPTPPIFPLLDRTSKPSTLPERPIDPSPTRQNGGGE
VKRPPLLDRATKPNAQNAQTSKQHEAQLLSIYDQMDMAIHRVVDDSTRNKGRGVPGAVGL
FNMGNTCFMSATLQCLFQTPGLAEVFTKKVFVSKVNTQSRLGSKGVISAGFASLSDMIWN
GTFTAIRPSRFLQLFSDTVYQPLSDGRQHDASEFQIFLLDALHEDTNQAQRISFEQNYHG
GAGIAKEAADFLKKHYQFSLSPVNRLLGSITVSEIRCLTCGASSATFEENTIISVEIPSN
SSCSLDMCLRSHFSQTKLDGDSRWNCPKCKEPRASTRTSKLWQPPPVMIIHLKRFALFNG
DFEKNTAAVTFETARFDVRPYLHEMAPAEKPVYKLYAATLHNGRLNSGHYTAVASHLRSD
KWLRFDDSVVTPCENFKVDPSLAYILFYKRC
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaactcatccggacttcaattcacaagtatgacggagcttcttgccacatgctcactt
acagagcagcaaacacgacaatttgagcaaaaatcgcttgatgtagtatatcaatctttg
aaaaatttgcaaggatctgctgaaaaagcccgtggagatttggagcaacaataccgatta
ttgatgaaagccggtgaactcggaaatattatcacgaaaagctcgaaatttgcgagatgg
aagcaaaatacagcaaatgcggcacttttctatgcggatttcgagaaagtcgttcgagaa
gcttcaaatttgcaatctgtgctgaatattaaatacgaaaatctggtccgacgtgctgac
acacaaaaacgtgccgaacaagaggctgcggataaacgtgcggcgacgattactgtagat
tcgacgatgcgggcggttcgggcaaagatcacaccgcgggaacttgtacgaaaagtggaa
aatgatacgccaaagaaaagcgcactgatttttgatattcgccaaaaccaatcggacgcg
attttctacaaccgaagcgagatgatcacagtgattcaggtgccatacgacatgatagac
agctccctaacattcgcttcgttccgcacgaatttggctgtaactcagcgagcactgctt
gctcggctctcaacgtctgattacgtagttctgatggatgatgatgggcctgaactcgtg
aacacgtcacctctgccgaaatccaaaatgtcgttccttttcaaggcgttgacgcagtac
aatcaatcggagcgtctacgcgaacggccaatgttcatggaaggtggattcaaaatgtgg
aaggctcaatatccgacgtacacgaagaatgagcagcccgtaacaccccgttcaatccca
tccgatgagcttgatgacgtcatttcggcctatcatcggaactatccgatgatctcggag
attcggtaccccgacttgaatacgatgcgtccagagccgacggctcagaccccacctgct
ccagcggctccaccagcggctccagcactcaatcggcagtcgacaataccgcccgtcgcg
atgactcaacgcccaatgattccgccttcattgccttcgagcacgcctcctgcaccttta
aaacctgtcgcaccgcccacgccgcccatcttcccgttgctggatcgaacatcaaagccc
tcgacacttccagaacgaccaatagatccatcgccgacacgtcagaatggaggtggagag
gtcaaacggccgccattgttggatagagcaactaagccgaatgctcagaatgctcagaca
tcaaaacagcatgaagctcagttgctctcgatctacgatcaaatggatatggcgattcac
cgtgtcgtcgacgattccacccgaaataagggtcgtggcgttccgggtgcagttgggctc
ttcaatatgggcaacacgtgcttcatgtctgccacgttgcagtgccttttccaaacgccg
ggactcgctgaagtgttcaccaagaaggttttcgtgtcaaaagtcaatacacagtcacgt
ctcggatcgaaaggtgtcatctctgctggttttgcgtcactttctgatatgatttggaat
ggaacgttcactgcgatcaggccttccaggtttttgcaactcttctcggataccgtctac
caaccactgagcgatggccggcaacacgatgcctctgaatttcagattttcttgttagac
gcgcttcacgaggacactaatcaggcacaacggatcagtttcgagcaaaactaccatggt
ggagccggaattgcaaaggaagcggcggattttctcaaaaaacactatcaattctcgtta
tcgccggttaatcggcttcttgggagcattaccgtgtcagaaatcagatgcctgacgtgc
ggagcttcttcggcgactttcgaggagaatacgataatttctgtggaaataccatccaat
tcgtcgtgctcactggatatgtgccttcgatcacacttttcgcaaactaaattggacgga
gattctcgttggaattgtccaaaatgcaaggagccacgtgcaagtacacggacatcaaaa
ctgtggcaaccaccaccggttatgatcatccatctgaagcgtttcgcgctgttcaacggg
gatttcgagaaaaacacggccgccgtgacatttgagaccgcccgattcgacgttcgaccg
tatttacatgagatggcgcctgccgagaagcccgtctacaagctttatgcggctacgctt
cacaacggtcgcctcaattcgggacactatacggctgtggcttcacatcttcgctctgac
aaatggcttcgtttcgatgattctgtcgtgacaccgtgtgaaaatttcaaagttgatcca
tcgctcgcctacattctcttctacaaacggtgctaa

DBGET integrated database retrieval system