KEGG   Caenorhabditis elegans (nematode): CELE_E01B7.1Help
Entry
CELE_E01B7.1      CDS       T00019                                 

Gene name
E01B7.1
Definition
Protein E01B7.1
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cel04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(17924987..17925090,17925354..17925498,17925941..17926021,17926546..17926736,17927095..17927178,17927230..17927401,17928024..17928470,17928530..17928627,17929595..17929754,17930061..17930234,17930526..17930633,17931179..17931298,17931372..17931515,17932162..17932257,17932424..17932576,17933480..17933599,17933991..17934029)
Genome map
AA seq 811 aa AA seqDB search
MNSSGLQFTSMTELLATCSLTEQQTRQFEQKSLDVVYQSLKNLQGSAEKARGDLEQQYRL
LMKAGELGNIITKSSKFARWKQNTANAALFYADFEKVVREASNLQSVLNIKYENLVRRAD
TQKRAEQEAADKRAATITVDSTMRAVRAKITPRELVRKVENDTPKKSALIFDIRQNQSDA
IFYNRSEMITVIQVPYDMIDSSLTFASFRTNLAVTQRALLARLSTSDYVVLMDDDGPELV
NTSPLPKSKMSFLFKALTQYNQSERLRERPMFMEGGFKMWKAQYPTYTKNEQPVTPRSIP
SDELDDVISAYHRNYPMISEIRYPDLNTMRPEPTAQTPPAPAAPPAAPALNRQSTIPPVA
MTQRPMIPPSLPSSTPPAPLKPVAPPTPPIFPLLDRTSKPSTLPERPIDPSPTRQNGGGE
VKRPPLLDRATKPNAQNAQTSKQHEAQLLSIYDQMDMAIHRVVDDSTRNKGRGVPGAVGL
FNMGNTCFMSATLQCLFQTPGLAEVFTKKVFVSKVNTQSRLGSKGVISAGFASLSDMIWN
GTFTAIRPSRFLQLFSDTVYQPLSDGRQHDASEFQIFLLDALHEDTNQAQRISFEQNYHG
GAGIAKEAADFLKKHYQFSLSPVNRLLGSITVSEIRCLTCGASSATFEENTIISVEIPSN
SSCSLDMCLRSHFSQTKLDGDSRWNCPKCKEPRASTRTSKLWQPPPVMIIHLKRFALFNG
DFEKNTAAVTFETARFDVRPYLHEMAPAEKPVYKLYAATLHNGRLNSGHYTAVASHLRSD
KWLRFDDSVVTPCENFKVDPSLAYILFYKRC
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaactcatccggacttcaattcacaagtatgacggagcttcttgccacatgctcactt
acagagcagcaaacacgacaatttgagcaaaaatcgcttgatgtagtatatcaatctttg
aaaaatttgcaaggatctgctgaaaaagcccgtggagatttggagcaacaataccgatta
ttgatgaaagccggtgaactcggaaatattatcacgaaaagctcgaaatttgcgagatgg
aagcaaaatacagcaaatgcggcacttttctatgcggatttcgagaaagtcgttcgagaa
gcttcaaatttgcaatctgtgctgaatattaaatacgaaaatctggtccgacgtgctgac
acacaaaaacgtgccgaacaagaggctgcggataaacgtgcggcgacgattactgtagat
tcgacgatgcgggcggttcgggcaaagatcacaccgcgggaacttgtacgaaaagtggaa
aatgatacgccaaagaaaagcgcactgatttttgatattcgccaaaaccaatcggacgcg
attttctacaaccgaagcgagatgatcacagtgattcaggtgccatacgacatgatagac
agctccctaacattcgcttcgttccgcacgaatttggctgtaactcagcgagcactgctt
gctcggctctcaacgtctgattacgtagttctgatggatgatgatgggcctgaactcgtg
aacacgtcacctctgccgaaatccaaaatgtcgttccttttcaaggcgttgacgcagtac
aatcaatcggagcgtctacgcgaacggccaatgttcatggaaggtggattcaaaatgtgg
aaggctcaatatccgacgtacacgaagaatgagcagcccgtaacaccccgttcaatccca
tccgatgagcttgatgacgtcatttcggcctatcatcggaactatccgatgatctcggag
attcggtaccccgacttgaatacgatgcgtccagagccgacggctcagaccccacctgct
ccagcggctccaccagcggctccagcactcaatcggcagtcgacaataccgcccgtcgcg
atgactcaacgcccaatgattccgccttcattgccttcgagcacgcctcctgcaccttta
aaacctgtcgcaccgcccacgccgcccatcttcccgttgctggatcgaacatcaaagccc
tcgacacttccagaacgaccaatagatccatcgccgacacgtcagaatggaggtggagag
gtcaaacggccgccattgttggatagagcaactaagccgaatgctcagaatgctcagaca
tcaaaacagcatgaagctcagttgctctcgatctacgatcaaatggatatggcgattcac
cgtgtcgtcgacgattccacccgaaataagggtcgtggcgttccgggtgcagttgggctc
ttcaatatgggcaacacgtgcttcatgtctgccacgttgcagtgccttttccaaacgccg
ggactcgctgaagtgttcaccaagaaggttttcgtgtcaaaagtcaatacacagtcacgt
ctcggatcgaaaggtgtcatctctgctggttttgcgtcactttctgatatgatttggaat
ggaacgttcactgcgatcaggccttccaggtttttgcaactcttctcggataccgtctac
caaccactgagcgatggccggcaacacgatgcctctgaatttcagattttcttgttagac
gcgcttcacgaggacactaatcaggcacaacggatcagtttcgagcaaaactaccatggt
ggagccggaattgcaaaggaagcggcggattttctcaaaaaacactatcaattctcgtta
tcgccggttaatcggcttcttgggagcattaccgtgtcagaaatcagatgcctgacgtgc
ggagcttcttcggcgactttcgaggagaatacgataatttctgtggaaataccatccaat
tcgtcgtgctcactggatatgtgccttcgatcacacttttcgcaaactaaattggacgga
gattctcgttggaattgtccaaaatgcaaggagccacgtgcaagtacacggacatcaaaa
ctgtggcaaccaccaccggttatgatcatccatctgaagcgtttcgcgctgttcaacggg
gatttcgagaaaaacacggccgccgtgacatttgagaccgcccgattcgacgttcgaccg
tatttacatgagatggcgcctgccgagaagcccgtctacaagctttatgcggctacgctt
cacaacggtcgcctcaattcgggacactatacggctgtggcttcacatcttcgctctgac
aaatggcttcgtttcgatgattctgtcgtgacaccgtgtgaaaatttcaaagttgatcca
tcgctcgcctacattctcttctacaaacggtgctaa

DBGET integrated database retrieval system