KEGG   Caenorhabditis elegans (nematode): CELE_E02H4.3Help
Entry
CELE_E02H4.3      CDS       T00019                                 

Gene name
tag-172
Definition
Protein TAG-172, isoform B
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CELE_E02H4.3 (tag-172)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   CELE_E02H4.3 (tag-172)
Spliceosome [BR:cel03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CELE_E02H4.3 (tag-172)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(14285476..14285527,14285709..14285851,14286107..14286194,14286468..14286630,14286740..14286863,14286912..14287082,14287155..14287245,14288950..14289130,14289186..14289300,14293607..14293688,14293974..14293993))
Genome map
AA seq 409 aa AA seqDB search
MIANSKTIKIVNKKQAAISRPRVPIVPHQRTPIPASQARPKVPEIVSSQRTQHQDDKDGH
LIYSKGDFILNRFTIYDTLGEGTFGKVVRVNDSLSDTFMALKIIKNVSKYREAAKLEVKV
LQKLAEKDPEKKNWVIHMGSYFDYNGHICLLFDLMGSSIFDFLKANHYKPYPMEQTLHIT
WQLCNAVKFLHDNKLTHTDLKPENILFVDSRYTTKLVDKKPLRVLHSTHVRLIDFGSATF
DHEHHSIIVSTRHYRAPEVILELGWSQPCDVWSIGCILYELYTGVTLFQTHENREHLAMM
ERVLGDIPLRMAKRTKTKFFINGRLDWVNTSADAAYVRDNCKPLRRSMSCTDPEHVELFE
LIENMLMFEPLARMKLPEALQHRYFNRLPENLKIPCKMDASTNPRINGD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgaactcgaaaaccatcaaaattgtcaacaagaaacaagccgccatttcacga
cctcgcgttccaatcgtcccacatcagagaacgccgataccggcaagccaggcacgacca
aaagttcctgaaattgtttcaagtcaacggacacagcaccaagacgataaagatggtcac
ttgatctactcgaaaggagatttcattttgaatcgtttcaccatttacgatacacttgga
gaaggaacatttgggaaagtggtacgggtgaatgactcattatcggacacgttcatggcc
ttgaagattataaagaatgtaagcaaatatcgagaagctgccaagttggaagtgaaggtg
ttgcaaaagttggcagagaaggatccggaaaagaaaaactgggtgatccacatgggctcg
tactttgactacaacggacacatctgtctgctttttgacctgatgggttccagcattttt
gatttcttgaaagccaatcattacaagccatatccaatggaacaaacgctgcatataacg
tggcagctttgcaacgccgtcaagtttttgcacgacaataagctgactcacacagattta
aagccggagaacattttgtttgttgacagtcgttacaccacaaaactagtggataaaaag
cctttgcgagttcttcacagtacacacgtgaggttaattgatttcggatcggcaaccttc
gatcatgagcatcattcaattattgtctcgacacgacattaccgagctccggaagtcatt
cttgaacttggctggtctcaaccgtgtgacgtttggtccatcggatgtatcctatacgag
ctctacactggcgtcactctcttccaaactcacgaaaaccgcgaacacttggcaatgatg
gaacgcgtgctcggtgacattccgctcagaatggcaaagaggacaaaaaccaaattcttc
atcaatggtcggcttgattgggtgaacacttcagctgacgcagcctacgtgagagacaat
tgcaaaccattaagacgttccatgtcttgtacagacccagaacacgtggagctgtttgaa
ctcattgagaacatgttgatgtttgagcctcttgctcgtatgaaacttcccgaagcactt
cagcatcgctactttaatcggttgccggaaaacttgaagattccttgcaaaatggacgct
tctacaaacccacggattaatggtgactag

DBGET integrated database retrieval system