KEGG   Caenorhabditis elegans (nematode): CELE_E04A4.7Help
Entry
CELE_E04A4.7      CDS       T00019                                 

Gene name
cyc-2.1
Definition
Protein CYC-2.1
Orthology
K08738  
cytochrome c
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CELE_E04A4.7 (cyc-2.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:complement(join(4748055..4748210,4748262..4748441))
Genome map
AA seq 111 aa AA seqDB search
MSDIPAGDYEKGKKVYKQRCLQCHVVDSTATKTGPTLHGVIGRTSGTVSGFDYSAANKNK
GVVWTRETLFEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIEVESAKSL
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatcccagctggagattacgaaaagggaaagaaggtgtacaagcagagatgc
ttgcagtgccacgtcgttgactcgaccgccacaaagaccggaccaaccctccacggagtt
atcggacgtacatcaggaactgtgtctggattcgactattccgctgctaacaagaacaag
ggagtcgtctggacccgcgagaccctcttcgagtacctcctcaacccaaagaagtacatc
ccaggaaccaagatggtgttcgctggactcaagaaggctgacgagcgtgcagatctcatc
aagtacatcgaggttgaatccgccaagtccctctaa

DBGET integrated database retrieval system