KEGG   Caenorhabditis elegans (nematode): CELE_F07A11.4Help
Entry
CELE_F07A11.4     CDS       T00019                                 

Gene name
F07A11.4
Definition
(RefSeq) Ubiquitin carboxyl-terminal hydrolase
  KO
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_F07A11.4 (F07A11.4)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_F07A11.4 (F07A11.4)
Ubiquitin system [BR:cel04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CELE_F07A11.4 (F07A11.4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
II:join(11603957..11604051,11605802..11606311,11606858..11607464,11607569..11608117,11608684..11609304,11609425..11609932,11610096..11610217,11610263..11610489,11611258..11611306)
Genome map
AA seq 1095 aa AA seqDB search
MRKTDDGGGSGRLSSSCSSIRSSNYSRSYTPSFNTFKYSPSSYTPNISRNLNTTSTGSTT
SDTPKLSSSSAPRSRLSFTTPSSTSTNLPRTSITSHKTLYSSPAAARVSVSTNDSLSHST
PHNTYRGISKYSTIERSTVADTKPYYSSATSSLSSTYDSRRHSRSDRISSSTLPDVKIET
GPTTRTHMVHPTSSHIRSRSSYGRSNTVSMFAQQARERADREEKDRDYKEWMQKEKDRET
ELGLETLYPTTSSSSSAQSSAQSEFRRSVAPSPTSTSTTTPYRSNRYSSATRGGNSSSAA
PLDDIMSTSYSSVAATPPPAYSQLSTSTSTLLRTRRERLEREEEGRNSSSMTPQPQSLVP
PPPPPPPPPPSAASNGRSGYLPRSVSAAVISSASSSSVYKPTAMVLPYEEDREKVCVVEQ
GYTGLRNIGNTCFMNAVLQMLVNNIELREYFLRNHYQPEINETNPLGSEGRLAKAFADFM
HQMWSGHQKAIEPTQIKNIVAEKASQFANFAQHDAHEFLSFLLDGLHEDVNRVKKKPLTG
TVESHGRHDLDVSNEAWKNHILRNDSIFVDLFHGQLKSHVQCPNCDRVSITFDPFVYLPV
PFPKNKQSTDLIFWPLENQTKPYKLTVSYSTEGTVADFLSVVSETVRVPTRNLRACEAIC
HKFDKIYSLDMKVSDIVSPDRLFVFQTHDEMEFNEEIVILHVLQRELYRKNTKHACHECG
NSKLKLKACEECYDAVYCSKECQVANWSTGGHREECSKRKPSETVGHPLIVSLPRSQLTY
QHLYRVLEAKSRHTPPGESSSSSSVSSTPRRRSVAAEPRTKNQKMFEIRKLSGQNDSFGS
HSISDDEACQSLESGGYVSVNWINQRNGKPYITIENRKDIDVDVEKSRQMNSRNMNGYVK
SNNSETNPHLTQMLDLFSETERLKPEESWYCSTCKENVEATKKLQLYRLPPVLIIQLKRF
VYTAFTYQSSMARRSKDTRSVEYPLESLDMSPFLAETSPHPNSTMYDLTGVVCHSGNSYF
GHYISMGRLADFDSSKTKIEWRNFDDSTVARQSTSTLQTEDAYLLFYKMRDQNVTRSIFK
RHYSCDPGAPEEVKI
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaaccgatgatggtggtggaagtggtcgtctatcgagttcgtgttcatcgatc
cgtagttccaactactcaagatcctatactccaagcttcaacaccttcaaatactctcca
tcatcatacacacccaacatctcacgtaatctgaacacaacgtccactgggtcgacgaca
tctgatactccgaaactgtcatcgtcgtcggccccacgttcgcgtctatccttcaccaca
ccatcctcaacttctacaaatcttccgcgaacaagcatcacatctcacaagactttgtac
agtagtcctgctgctgcacgtgtctccgtctccacaaatgatagtctctcacattcgaca
ccacacaatacatatcgaggaatctccaagtacagtaccatcgaacgatctactgttgca
gacacaaaaccgtactattcgtctgccacatcatcactttcaagtacttatgatagtaga
agacactcaagaagcgatagaatatcttcatccacattgcctgatgtgaagattgaaact
ggtccgactacgaggacccacatggtgcatccaacatcttctcatatcagaagccgatcg
tcatatggccgctccaacactgtctcaatgttcgctcaacaagctcgagaacgcgcagac
cgagaagagaaggatcgagattacaaggaatggatgcaaaaggagaaggatcgagagaca
gaactaggtctggaaactctttatccaactacatcatcctcctcatcggctcaatcttct
gctcaatccgagttccgtagatcagttgccccttcacccacatccacatctacaacaact
ccatatcgttcaaatcggtactcatcagcaacacgtggtggcaacagttcttcagcagct
cctttggatgatatcatgtcaacctcgtattccagtgtcgcagcaactcctccaccagcg
tattctcaactttccacgtcgacatctacccttttaagaacaagaagagaacgtctggaa
cgagaagaagagggaaggaattcatcgtcaatgacacctcaaccacaatctcttgttcca
cctccacctcctccaccgccaccaccgccatcagcggcctccaacggtagaagtgggtac
cttccaagaagtgtgtcagcagcagtgatatcgtcagcatcgtcgagttcggtgtataag
ccaacagcgatggttctcccatacgaagaggatcgtgaaaaagtttgtgtcgttgagcaa
ggctacactggtctccgaaacattggaaacacatgtttcatgaatgcagtactccagatg
cttgtcaacaatattgaactccgcgagtacttcctccgtaaccactatcaacccgagatc
aacgagacgaatccactcggatcagaaggtcgtttggcaaaagcatttgcagatttcatg
caccaaatgtggagtgggcatcagaaggccatcgagccaacgcagatcaagaatatcgtt
gccgagaaggcatcacagtttgccaattttgcacaacacgatgcacatgaattcctctcg
tttctgctagatggactacacgaagacgtgaatcgagtgaagaagaagccactgacaggg
acggttgaaagtcatggaagacatgatcttgacgtgtcgaatgaagcatggaaaaatcat
attttaaggaatgattccatttttgtggatttgtttcatggacagttgaagagtcatgta
caatgtccaaattgtgatagggtctccatcacattcgacccatttgtctatcttcctgta
ccattcccgaagaacaaacagtcaacggatctcatcttctggccactggaaaaccagaca
aagccttacaaactaacagtcagctactccacagaaggaactgtcgccgattttctatca
gttgtcagtgaaactgttcgagttccgacgagaaatcttcgagcgtgtgaagcaatttgt
cataagtttgacaaaatctacagtctggacatgaaagtttctgatatcgtttcaccggat
cgtttgttcgtttttcaaactcatgatgaaatggaattcaatgaggaaattgtgattctt
catgtgcttcaacgagaattatatcgaaagaatacgaaacatgcttgccatgagtgtgga
aattcaaagttgaagctgaaggcttgtgaagagtgttatgatgctgtctattgctccaaa
gagtgtcaagttgcaaactggtcaactggagggcaccgtgaagagtgctcaaaacggaag
ccaagtgagacagtcgggcatccgttaatcgtttcccttccaagatcccagctaacttat
cagcatttgtatagagttctggaggcaaaaagtcggcatactccaccaggagaatcatcc
agctcatccagtgtatcatcaactccacgaagaagaagtgtggcagcagagccaaggacc
aaaaatcagaaaatgtttgaaattaggaaactatccggccaaaatgattcctttggcagt
cacagtattagcgatgatgaagcatgtcagagtttggagtcaggaggatatgtgtcagtt
aactggatcaatcagagaaatggaaagccatatattacaattgaaaatcgtaaagatatt
gatgtagatgtggagaagagtagacaaatgaactccaggaacatgaatggttatgtgaag
agtaacaattcggagacgaatccacatctcacacaaatgcttgacttgttctcggaaact
gagaggttgaaaccagaagagagttggtattgctcgacgtgcaaagagaatgtggaggct
accaagaagcttcagttgtataggttgccgcctgttctgatcattcagttgaagagattc
gtctatacagcattcacttatcaatcatcaatggctcgtcgaagcaaggacacccgatca
gttgagtatccattggagagtcttgatatgtctccgtttttagcagaaacatctccacat
cctaattcaacgatgtatgatctaacgggagtagtatgccatagtggaaacagttacttc
ggtcattatattagtatgggtcgactcgccgattttgattcgtcgaaaacgaaaatcgaa
tggaggaatttcgatgattcgacggtggctcggcagtctacgagcactttacaaacggag
gatgcttacttactcttctataaaatgagagatcagaatgtgacgaggagtatattcaaa
cgccactactcgtgtgatcctggagctccagaagaagtcaaaatttag

DBGET integrated database retrieval system