KEGG   Caenorhabditis elegans (nematode): CELE_F08G2.1Help
Entry
CELE_F08G2.1      CDS       T00019                                 

Gene name
his-44
Definition
(RefSeq) Histone H2B 1
  KO
K11252  histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CELE_F08G2.1 (his-44)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_F08G2.1 (his-44)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W Endonuc-HincII DUF1931
Motif
Other DBs
NCBI-GeneID: 175033
NCBI-ProteinID: NP_496897
WormBase: WBGene00001918
Ensembl: WBGene00001885 WBGene00001889
UniProt: P04255
Position
II:complement(13826730..13827098)
Genome map
AA seq 122 aa AA seqDB search
MPPKPSAKGAKKAAKTVTKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMN
SFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagccatctgccaagggagccaagaaggccgccaagaccgttacgaagcca
aaggacggaaagaagagacgtcatgcccgtaaggaatcatactccgtctacatctaccgt
gtcctcaagcaagttcatccagacactggagtttcctccaaagccatgtctatcatgaac
tcttttgtcaacgatgtcttcgagcgtattgctgctgaagcatcccgtcttgctcactac
aacaagcgttccacaatctcatcccgcgaaattcagaccgctgtccgtctgatccttcca
ggagagcttgccaagcacgccgtgtctgagggaaccaaggccgttaccaagtacacttcc
agcaagtaa

DBGET integrated database retrieval system