KEGG   Caenorhabditis elegans (nematode): CELE_F09E8.6Help
Entry
CELE_F09E8.6      CDS       T00019                                 

Gene name
nas-14
Definition
Protein NAS-14
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(13170560..13170677,13170730..13170941,13171220..13171311,13171366..13171558,13172160..13172679,13173294..13173670)
Genome map
AA seq 503 aa AA seqDB search
MRLLYSLFHCSAFLVGFTLSVGVLPIPNEHAASIKAKFDDYAEHYLLPEDFHNAETAPVK
KPTDAEIESMQNSLLFEGDIMGVPEIEKSDILKRLRDDPLLDEDEIFRKPFHSALNLVTY
PDKLWPEGQVPYMLEEGMTNDQRTAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAF
GCSSYVGRAGGNQTVSLEVDKCFSKGIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRP
GMMRNFEKYPRKIIDSLGMPYDYESVMHYHKLAFSRNGKPTIIPKDNEADVGQRYKLSEM
DSKKVNKLYQCGEYSKTSSTTTTTTTTTTTTTTEEPTTTTEVEEKPKDKKVSSTTTTTKK
PTTTTTTTPKPVERSRNKKCEDLNAHCGMWEQLGHCQHSVKYMAHYCRKACNLCEVEVTT
TTTTTPKPVPRNKEKENKSASSTTRGTSTATSTTPKTTTTTTSAPKEKCEDKNLFCSYWA
KIGECNSESKFMKIFCKASCGKC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaggttactgtattcacttttccattgctccgcatttctcgttggcttcacactttcc
gtcggtgtcctgccgattccaaatgaacacgctgcgagtattaaggcaaagtttgatgac
tacgcagagcactatcttttgcccgaagattttcacaatgcagaaaccgcaccggttaaa
aaaccaacagacgccgagatcgagtcaatgcaaaattcgcttcttttcgaaggagatatt
atgggagttcctgaaattgaaaagtcggatattctgaagagactcagagatgatccactt
ctcgatgaagacgagatttttagaaaacctttccacagtgccttgaacttggtgacctat
cccgacaagctctggccggagggacaagttccatatatgctggaagaaggaatgactaat
gatcaaagaacagcaattgctcaagcatttgatgagtacaaaacgaagacatgtgttcga
tttgttcctaaaactgacgatgattttgattatatttatgtgaagagaaatgttgctttt
ggatgctcttcgtatgttggcagagctggtggaaatcagactgtgtcgttggaggttgat
aagtgcttttcgaagggaataattgctcacgaactgatgcacgctctaggattcttccac
gaacattcacgaaccgatcgagacgatttcgtagatataaacgaggataatattcgacca
ggaatgatgcgtaattttgaaaagtatccaagaaaaattattgattcacttggaatgcca
tatgactacgagtctgtcatgcattatcataagttggcattctccagaaatggtaaacca
actattattccaaaggacaatgaagcagatgttggacagagatataagctttctgagatg
gattctaagaaggttaataagctttatcaatgtggagagtattcgaaaacatcgtcaact
acaactactacaaccactacaaccactacaaccactacagaggagccaactacaactact
gaagtggaggagaagccgaaggataagaaggtgtcaagtacgacgactacaactaagaaa
ccgactactacaactacaactacgccaaaaccagtggaaagatccagaaataagaaatgc
gaagatctcaatgctcattgtggaatgtgggagcagcttggtcactgccagcattctgtg
aaatacatggcccactattgccgaaaagcttgtaatctctgcgaagtcgaggtcacaaca
accaccacaaccacccccaaaccagtaccacgtaacaaggaaaaagagaacaagtcggca
tcgtcaacgacacgtggcacctctactgccacatctacaactcccaaaacgacgacgaca
acgacgtcagctccaaaagaaaaatgtgaagataagaacttgttctgcagttattgggca
aagatcggagagtgtaatagtgagagcaagtttatgaaaatattctgtaaagcttcgtgt
gggaagtgttaa

DBGET integrated database retrieval system