KEGG   Caenorhabditis elegans (nematode): CELE_F09E8.6Help
Entry
CELE_F09E8.6      CDS       T00019                                 

Gene name
nas-14
Definition
Protein NAS-14
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_F09E8.6 (nas-14)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_F09E8.6 (nas-14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(13170584..13170701,13170754..13170965,13171244..13171335,13171390..13171582,13172184..13172703,13173318..13173694)
Genome map
AA seq 503 aa AA seqDB search
MRLLYSLFHCSAFLVGFTLSVGVLPIPNEHAASIKAKFDDYAEHYLLPEDFHNAETAPVK
KPTDAEIESMQNSLLFEGDIMGVPEIEKSDILKRLRDDPLLDEDEIFRKPFHSALNLVTY
PDKLWPEGQVPYMLEEGMTNDQRTAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAF
GCSSYVGRAGGNQTVSLEVDKCFSKGIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRP
GMMRNFEKYPRKIIDSLGMPYDYESVMHYHKLAFSRNGKPTIIPKDNEADVGQRYKLSEM
DSKKVNKLYQCGEYSKTSSTTTTTTTTTTTTTTEEPTTTTEVEEKPKDKKVSSTTTTTKK
PTTTTTTTPKPVERSRNKKCEDLNAHCGMWEQLGHCQHSVKYMAHYCRKACNLCEVEVTT
TTTTTPKPVPRNKEKENKSASSTTRGTSTATSTTPKTTTTTTSAPKEKCEDKNLFCSYWA
KIGECNSESKFMKIFCKASCGKC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaggttactgtattcacttttccattgctccgcatttctcgttggcttcacactttcc
gtcggtgtcctgccgattccaaatgaacacgctgcgagtattaaggcaaagtttgatgac
tacgcagagcactatcttttgcccgaagattttcacaatgcagaaaccgcaccggttaaa
aaaccaacagacgccgagatcgagtcaatgcaaaattcgcttcttttcgaaggagatatt
atgggagttcctgaaattgaaaagtcggatattctgaagagactcagagatgatccactt
ctcgatgaagacgagatttttagaaaacctttccacagtgccttgaacttggtgacctat
cccgacaagctctggccggagggacaagttccatatatgctggaagaaggaatgactaat
gatcaaagaacagcaattgctcaagcatttgatgagtacaaaacgaagacatgtgttcga
tttgttcctaaaactgacgatgattttgattatatttatgtgaagagaaatgttgctttt
ggatgctcttcgtatgttggcagagctggtggaaatcagactgtgtcgttggaggttgat
aagtgcttttcgaagggaataattgctcacgaactgatgcacgctctaggattcttccac
gaacattcacgaaccgatcgagacgatttcgtagatataaacgaggataatattcgacca
ggaatgatgcgtaattttgaaaagtatccaagaaaaattattgattcacttggaatgcca
tatgactacgagtctgtcatgcattatcataagttggcattctccagaaatggtaaacca
actattattccaaaggacaatgaagcagatgttggacagagatataagctttctgagatg
gattctaagaaggttaataagctttatcaatgtggagagtattcgaaaacatcgtcaact
acaactactacaaccactacaaccactacaaccactacagaggagccaactacaactact
gaagtggaggagaagccgaaggataagaaggtgtcaagtacgacgactacaactaagaaa
ccgactactacaactacaactacgccaaaaccagtggaaagatccagaaataagaaatgc
gaagatctcaatgctcattgtggaatgtgggagcagcttggtcactgccagcattctgtg
aaatacatggcccactattgccgaaaagcttgtaatctctgcgaagtcgaggtcacaaca
accaccacaaccacccccaaaccagtaccacgtaacaaggaaaaagagaacaagtcggca
tcgtcaacgacacgtggcacctctactgccacatctacaactcccaaaacgacgacgaca
acgacgtcagctccaaaagaaaaatgtgaagataagaacttgttctgcagttattgggca
aagatcggagagtgtaatagtgagagcaagtttatgaaaatattctgtaaagcttcgtgt
gggaagtgttaa

DBGET integrated database retrieval system