KEGG   Caenorhabditis elegans (nematode): CELE_F09F7.4Help
Entry
CELE_F09F7.4      CDS       T00019                                 

Gene name
F09F7.4
Definition
Protein F09F7.4, isoform B
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CELE_F09F7.4 (F09F7.4)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CELE_F09F7.4 (F09F7.4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CELE_F09F7.4 (F09F7.4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CELE_F09F7.4 (F09F7.4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     CELE_F09F7.4 (F09F7.4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(5555599..5555976,5556029..5556402,5556601..5556821,5556872..5556990)
Genome map
AA seq 363 aa AA seqDB search
MSFSVSAAAKSEILVDTHGSKKVVTLNRPKALNALNLEMVREFYPKLQAWNSSSDVDLVI
LKGSGDKAFCAGGDVLAVVRSFKDSESGKECTMHKDFFREEYILNHLIGTLNKQYVCLID
GIVMGGGCGLSVNGRFRVATEKTMLAMPETALGLFPDVGGSYFLSRLKGNLGMYLALTGY
RLLGADAFHAGLATHFVESSELAKLEKELVNIKDVTENSVDEVIRSFEPKKIPEFSLSKN
LAQIRDSFKAKSVEEILASLEKDGSDWAKKQAATLGKMSPTSLKVTHRQITEGSKMSYAK
IFTMEYRLTQRFLADKDFHEGCRAILVDKDRKPKWNPATLADVKDSVVDNYFSPLPNNSD
LKL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctccgtgagcgccgccgccaagtcggaaatccttgtcgacacacacggatcg
aagaaggtggttacattgaataggcctaaagcgctaaacgcgttgaacctcgaaatggta
cgagagttttatcccaaacttcaagcctggaattcatcttccgatgtggatcttgtcatt
ttgaaaggatccggtgataaggcgttctgtgctggaggagatgttcttgccgttgtgcga
tctttcaaagattcggagagtggaaaagagtgcacaatgcacaaggatttcttccgcgag
gagtacattttaaatcatttaattggaactttgaataagcaatacgtttgtctgattgat
ggaattgtgatgggaggaggttgtggtctttctgtaaatggacgtttccgagttgccact
gagaaaacaatgctagcaatgccagaaaccgcacttggactcttcccagacgtcggtgga
tcctatttcctttcaaggctcaagggaaacctcggaatgtacttggcactcactggatat
cgtcttctaggtgctgacgctttccatgctggtcttgccactcattttgtggagtcttcg
gaacttgcgaaattggaaaaggaacttgtgaatattaaggatgtgacagagaactctgtc
gatgaagtcatcagatcgttcgagccaaagaagattccagaattcagtctgtccaagaat
ttggctcaaattagagattccttcaaagcaaaaagcgtcgaagaaatcctcgcaagcctc
gaaaaagacggatccgactgggcaaagaagcaagcagccactctaggaaaaatgagccca
acttccctgaaagtaactcaccgacaaatcaccgaaggaagcaagatgagctatgcaaag
atcttcacaatggagtatcgtctcactcaacgattcctcgccgataaggatttccatgaa
gggtgccgagccattctcgttgacaaggatcgcaagccaaagtggaatccagcgacgttg
gctgatgtgaaggattctgtcgtcgataactatttctcgccattgccaaataattctgat
ttaaaattgtag

DBGET integrated database retrieval system