KEGG   Caenorhabditis elegans (nematode): CELE_F10D2.9Help
Entry
CELE_F10D2.9      CDS       T00019                                 

Gene name
fat-7
Definition
Protein FAT-7
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CELE_F10D2.9 (fat-7)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CELE_F10D2.9 (fat-7)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CELE_F10D2.9 (fat-7)
Lipid biosynthesis proteins [BR:cel01004]
 Desaturase
  First
   CELE_F10D2.9 (fat-7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(7151447..7151726,7151997..7152158,7152207..7152543,7152782..7152902,7153015..7153131))
Genome map
AA seq 338 aa AA seqDB search
MTVKTRASIAKKIEKDGLDSQYLFMDPNEVLQVQEESKKIPYKMEIVWRNVALFAALHVA
AAIGLYELVFHAKWQTAVFSFALYVFSGFGITAGAHRLWSHKSYKATTPMRIFLMLLNNI
ALQNDIIEWARDHRCHHKWTDTDADPHNTTRGFFFTHMGWLLVRKHPQVKEHGGKLDLSD
LFSDPVLVFQRKHYFPLVILFCFILPTIIPVYFWKETAFIAFYVAGTFRYCFTLHATWCI
NSAAHYFGWKPYDTSVSAVENVFTTVVAVGEGGHNFHHTFPQDYRASEYSLIYNWTRVLI
DTAAVLGLVYDRKTIADEFISRQVANHGSEESRKKSIM
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacggtaaaaactcgcgcgagcattgccaagaagattgaaaaagatggtttggactct
caatacctgttcatggatccaaatgaagtcctgcaagtccaagaggagagcaaaaaaatt
ccatacaaaatggaaatagtgtggcgtaacgtggctctctttgctgctctgcacgtcgcc
gcagccattggactttacgagcttgtcttccatgctaaatggcaaacggccgtcttctca
tttgctctctatgtgttctcaggattcggtatcacagctggagcccatcgtctctggtct
cataaatcatacaaggcaaccacaccaatgagaatctttttgatgctcttgaacaacatt
gctcttcaaaacgacatcattgaatgggctcgtgatcatcgttgccatcacaagtggact
gatacagatgctgatccacataacaccacccgtggattcttcttcactcacatgggatgg
cttcttgtgcgtaagcatccacaagttaaggagcatggaggcaaactcgacctatctgat
ctatttagcgatccagttcttgtattccagagaaagcactatttcccactggtcattttg
ttttgtttcattcttccaacaattatccccgtttatttctggaaggagacagcattcatt
gcgttttacgtagctggaacattccgttattgtttcacacttcacgccacttggtgcatc
aacagcgctgctcactattttggttggaagccatacgatacttctgtttccgccgttgag
aacgtctttaccacagttgtagccgttggtgaaggaggtcacaatttccaccacacattc
ccacaagactacagagcatctgaatattcattgatatacaattggacccgtgttcttatt
gatactgcagctgttcttggtcttgtctacgatagaaaaacaattgccgatgagtttatc
agccggcaggttgccaatcacggaagtgaagaatcaagaaaaaaatcgatcatgtaa

DBGET integrated database retrieval system