KEGG   Caenorhabditis elegans (nematode): CELE_F10G8.3Help
Entry
CELE_F10G8.3      CDS       T00019                                 

Gene name
rae-1
Definition
Protein RAE-1
Orthology
K14298  
mRNA export factor
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_F10G8.3 (rae-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(10026644..10026751,10026796..10026888,10027752..10028585,10029642..10029728)
Genome map
AA seq 373 aa AA seqDB search
MFGSSGFGNKSMFGGSNISTSTTTPAANTTQNDDFLVDGAPEDTIQVIKFSPTPQDKPML
ACGSWDGTIRVWMFNDANTFEGKAQQNIPAPILDIAWIEDSSKIFIACADKEARLWDLAS
NQVAVVGTHDGPVKTCHWINGNNYQCLMTGSFDKTLRFWDMKNLPNQTQMAQIQLPERVY
AADVLYPMAVVALANKHIKVYNLENGPTEVKDIESQLKFQIRCISIFKDKSNQNPAGFAL
GSIEGRVAVQYVDVANPKDNFTFKCHRSAELVNGFQEIYAVNDICFHPQHGTLVTIGSDG
RYSMWDKDARTKLKTSEPHPMPLTCCDVHSSGAFLVYALGYDWSRGHEGNTQPGSKIVIH
KCIEDMKPRPTKK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgttcggatcgtcgggatttggcaataaatcgatgttcggaggatcgaatatttcaacc
tcgacaactactcccgctgccaacactacacagaatgatgactttctggttgatggagct
ccagaggacacaattcaggtcatcaagttcagccccacaccgcaagataaaccaatgctg
gcatgcggatcttgggacggtacaattcgagtgtggatgttcaatgatgccaacacattc
gaaggaaaagcacagcaaaacattccagctccaattctagatatcgcctggattgaagac
agttctaaaattttcatcgcatgtgctgacaaagaagctcgtctgtgggacctcgcttct
aatcaggttgcagttgtcggaacacatgatggaccagtgaagacttgtcactggattaat
ggaaacaactatcagtgtctgatgaccggatcattcgataaaactcttcgattttgggac
atgaagaatctaccaaatcagacacaaatggcacagattcaattaccggaaagagtttat
gcagccgatgtgctatatccgatggcagttgttgcactagctaacaagcatatcaaagtt
tataatctggaaaatggaccaacagaagtgaaagatattgaaagtcaattaaagttccag
atcagatgtatctcaattttcaaggataaatcgaatcaaaatcccgctggattcgctcta
ggatctattgaaggtcgagtagctgtacaatacgtggatgttgcaaatccaaaagacaac
ttcacattcaaatgtcatcgatcagctgaacttgtgaacggatttcaagaaatttacgct
gtcaatgatatttgcttccatccacaacacggaactctggtcacaattggttcagatggc
cgttattcaatgtgggacaaggatgcacggacaaagctgaagacatcagaaccacatcca
atgccgttgacatgctgtgatgttcatagttcgggtgctttccttgtctatgcattgggc
tatgattggagtcgaggtcacgaaggaaacactcaaccaggatcgaaaattgtaatccac
aaatgtatcgaagatatgaaaccacgaccgactaagaaataa

DBGET integrated database retrieval system