KEGG   Caenorhabditis elegans (nematode): CELE_F11E6.1Help
Entry
CELE_F11E6.1      CDS       T00019                                 

Gene name
gba-3
Definition
(RefSeq) GBA-3, isoform D
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CELE_F11E6.1 (gba-3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CELE_F11E6.1 (gba-3)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CELE_F11E6.1 (gba-3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CELE_F11E6.1 (gba-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:join(17473334..17473397,17477109..17477318,17477385..17477668,17477718..17477884,17477933..17478308,17478855..17479102,17479144..17479372)
Genome map
AA seq 525 aa AA seqDB search
MAFFSVRSSKIVFGLERSEEKGHASFQCNPKTYDGAFLNIVCVCNATFCDEIEPIGEIAE
GKAIVYRSSLDGDRLKRMSMKMKEKLRKNESVNVTITIDASERFQNIFGFGGAFTDSAGD
QFVSLSETLQNYIVDSYFGKNGLEYNIGRVPIASCDFSTHEYSYDDVHDDFELKHFALPD
EDLKLKIPFIKKAIEKTEGNIQLFASPWSAPGWMKVTGRMRGGGAMRNDKRVYQAYADYF
FKFFEAYSSHAITFWGLTIQNEPSTGADMAWRWQTMNYTAETMRDFLKKYLGPKLKENKL
TETLKVMVLDDGRGLLPGWADTIFNDPEATKYADGVAVHWYGNLYSPAVLLDITQRHHPT
KFIFGTEACAGYFGHHGPIMGDWFRAESYADDIITDLNHHVTGWTDWNLCLDETGGPNWA
YNVVDSPIIVNRTAQEFYKQPMFYALGHFSKFLPRGSTRVFTKIEGNLAVSATSVVIEGG
RRATVILSKASNSLLTRIVDSSTGFSIVLNLPPRSIHTVIWKKRK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggccttcttcagtgttcgttccagtaaaatagtattcggacttgagaggtctgaagaa
aaaggtcatgcttcttttcaatgcaacccaaaaacctatgacggcgcgtttctcaacatt
gtttgtgtttgcaacgcaacgttttgcgatgaaattgagccaataggagagatagctgaa
gggaaggcaattgtttatagatcaagtttggacggcgatagattgaaacgcatgagtatg
aaaatgaaagagaaattgagaaaaaatgaatcagttaatgtgacaattacaatagatgcc
agtgaaagatttcaaaatatttttggttttggaggagcatttactgattctgccggcgat
caatttgtttccttatcggagacacttcaaaattatatcgttgattcatattttggaaaa
aatggattagaatataatataggaagagttccaatagccagttgtgatttttctactcat
gaatatagctatgatgacgttcatgatgattttgaattaaaacattttgcattacctgat
gaagatttaaaactaaagattccatttatcaagaaagcaattgaaaaaactgaaggaaac
attcaattatttgccagtccatggtcagctcctggatggatgaaagttactggacgcatg
aggggcggaggagctatgagaaatgataagcgtgtttatcaagcgtacgctgattatttt
tttaaatttttcgaagcctattcatctcatgcaattaccttttggggactaacaattcaa
aatgagccatcaacaggagctgacatggcatggagatggcagactatgaattatacagca
gaaacgatgcgagattttctaaaaaaatatcttggcccaaaactgaaagaaaataaacta
acggaaactttgaaagttatggttttggatgatggaagaggattactccctggatgggct
gacactattttcaatgacccggaagcaaccaaatatgcagatggtgtagcagttcactgg
tatggtaacttgtattctcctgctgttcttcttgatattactcaaaggcatcatccaacc
aaatttatttttggaaccgaggcatgtgctggctactttggacatcatggtccaataatg
ggagactggttccgcgcagaaagttatgcagatgatatcatcactgatcttaatcatcac
gttacgggatggactgactggaatctttgccttgatgaaactggtgggccaaattgggcc
tacaatgttgtagattccccaatcattgtcaaccgaactgctcaagagttttacaaacaa
ccaatgttctatgcattgggccactttagtaaattccttccacgtggatctactcgtgtg
ttcacaaagatcgagggaaacctggctgtctcagctacaagtgttgtgattgaaggtgga
agacgagctacagttattttatcaaaagcgtccaactcattattgacacgtatagttgac
agttcaacaggattctctattgtgctgaatttgcccccaagatccattcatacagtgatt
tggaagaaaagaaaataa

DBGET integrated database retrieval system