KEGG   Caenorhabditis elegans (nematode): CELE_F13B10.2Help
Entry
CELE_F13B10.2     CDS       T00019                                 

Gene name
rpl-3
Definition
(RefSeq) 60S ribosomal protein L3
  KO
K02925  
large subunit ribosomal protein L3e
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    CELE_F13B10.2 (rpl-3)
Ribosome [BR:cel03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    CELE_F13B10.2 (rpl-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
EnsemblGenomes-Tr: 
UniProt: 
Position
III:join(3867863..3868227,3868445..3868580,3868629..3869069,3869205..3869468)
Genome map
AA seq 401 aa AA seqDB search
MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDV
DKPGSKVNKKEVVEAVTIVETPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYS
NWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYCSSIRVIAHTQMKILRRRQKKAHL
VEIQVNGGTIEQKVDWAREHLEKQVQVDTVFAQDEMIDTIGVTRGHGFKGVTSRWHTKKL
PRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGKSALTEEGKNNG
STEFDLTQKTITPMGGFPRYGIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKI
NLKWIDTSSKTGHGRFQTTAEKRAFMGKLKRDFLAEAEAKA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaccgaaagttttcggccccgagacatggacacatgggattcaccccaaagaag
cgctcccgcacttaccgtggaagaatcaaggctttcccaaaggatgacaagagcaagcca
atccatttgaccgctttcctcggatacaaggccggtatgacccatatcgtccgtgatgtc
gataagccaggatcaaaggttaacaagaaggaggttgtcgaagccgtcaccatcgtcgag
accccaccaatggttattgctggagttaccggatacgtcgacaccccacaaggaccacgt
gctcttaccaccatctgggccgagcacttgtccgaggaagctcgtcgtcgcttctacagc
aactgggctaaatccaagaagaaggctttcaccaagtacgccaagaagtggcaagatgag
gatggaaagaagctcatcgaggctgatttcgccaagctgaagaagtactgctcttctatc
cgtgtgatcgctcacactcagatgaagatccttcgccgtcgccaaaagaaggctcacctc
gtcgaaatccaagtcaacggaggaaccatcgagcagaaggtcgactgggctcgcgagcat
ctcgagaaacaagtccaggttgataccgtcttcgctcaggatgagatgattgacaccatc
ggagttaccagaggtcacggattcaagggagtcaccagcagatggcacaccaagaagctt
cctcgcaagacgcacaagggtctccgcaaggtcgcctgtattggagcttggcatccatct
cgtgtcgccttcactgtcgctcgtgctggacaaaagggattccatcaccgtaccatcatc
aacaacaagatctaccgtattggaaagtctgctctcactgaggaaggaaagaacaacgga
tccaccgagttcgatcttacccagaagaccatcaccccaatgggaggattcccaagatac
ggtatcgtcaaccaggactacatcatgcttcgtggagccgttctcggaccaaagaagcgt
cttatcaccctccgcaagtcgctcatcacccaaaccaagagagtcgcccacgagaagatc
aacctcaagtggatcgacaccagttccaagaccggacacggtcgcttccaaaccacagcc
gagaagcgtgctttcatgggaaaactcaagagagatttccttgccgaggccgaagctaag
gcttaa

DBGET integrated database retrieval system