KEGG   Caenorhabditis elegans (nematode): CELE_F13H6.3Help
Entry
CELE_F13H6.3      CDS       T00019                                 

Gene name
F13H6.3
Definition
Protein F13H6.3
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:cel00983]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(6363496..6363703,6363747..6363876,6363923..6364576,6364653..6364897,6365031..6365119,6365170..6365256,6365352..6365510,6365559..6365651))
Genome map
AA seq 554 aa AA seqDB search
MGGFLSHLTPEQNVEALKASCGPVRGNIYKHDDVIVDGYLGIPYAKPPVGELRFKKPVTV
DVWTEIKDCYKYGPACVQTGGFEQIAGPRTPTPEEAGCLTLNVFTPRNASSEFKNGRPVM
VYIHGGGYELCASSDFCAYSLSGTLPLKDVVVVSINYRLGVFGFLTTGDNVCPGNFGLWD
QTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCD
FAIRASENQAKIFREFAEFHGFSGRDSSALFKWYQEQSPETLSNVKGYKKSISGFLTFIP
NLDGDFFPKPLDELRKEAPKKQMMTGVTEYEGLMLASMNPAFSPADVGLTLMPQGIYGKD
VVSNPDEIQKIFYEKYVEGVDKSDELAMRKKLCEALGDEFFNVGVIQAAKNAAKHGNEVY
FYTFEYVNPDSFGMWDGMMPFKAAVHCTELRYLLGEGVYSKFEPTEEDRKVMETTTTLFS
NFAKYGNPNGKGATAEIWEKYSLNRPERHYRISYPKCEMRDVYHEGRIQFLEKIDGDSDK
YQELVYGKKKSAKI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgggtggattcttgtctcatctgactcctgaacagaatgttgaagcattgaaagcttct
tgtggtcccgtaagaggaaacatttataaacatgatgatgtgattgttgatgggtacctc
gggatcccgtatgcgaaaccaccagtcggcgaacttcgatttaagaagccagtaaccgtt
gatgtttggacagagatcaaagattgttataaatatggaccagcttgtgtacagactggt
ggatttgagcagattgctggtccaagaactccaactccggaagaggctggttgtctcaca
ctgaatgtgttcacacccagaaatgcatcttctgaatttaaaaatggacgaccggttatg
gtttacattcatggaggaggatacgagttgtgcgcatcctctgatttctgtgcttactcc
ctttccggaactctcccacttaaagatgtcgtggtagtttctattaactaccgcctcggt
gtgtttggattcctcaccactggagacaatgtctgtcctggaaattttggtctttgggat
cagactttggctcttaaatgggttcaaaaacatatttcttcatttggaggtgatccaaat
tgtgtgactgtctttggacaaagtgcaggaggagcaagtactgatttattatcattgagc
ccacattcaagagatttgttccagcgcttcattccaatttccggaacggctcattgtgac
tttgccattagagcatctgaaaatcaagccaagattttccgagaatttgcagagtttcat
ggtttttctggaagagattcgtcagcactcttcaagtggtaccaagagcaatcgccagaa
actctgtcaaatgtaaaaggatacaaaaaatcgatttctggattcctcacattcattcct
aacttggatggagatttcttcccgaaaccattggatgagctaagaaaggaagctccaaag
aagcaaatgatgactggagttactgagtatgaaggtcttatgttagcatcaatgaatcca
gcattttctcctgctgatgtcgggttgacacttatgcctcaaggaatttatggaaaagat
gtggttagcaatccggatgaaattcagaagattttctatgaaaaatacgtcgaaggagtt
gacaaatcagatgagttggcgatgagaaagaaactatgtgaagctctcggagatgaattt
ttcaacgtaggagtgattcaggcagccaaaaatgctgccaagcatggaaatgaggtgtac
ttctacactttcgaatacgtgaatccagatagttttggaatgtgggatggaatgatgccg
ttcaaggctgctgttcattgcaccgagctcagatatcttctcggtgaaggagtttacagc
aagttcgaaccaacagaggaagatcggaaagttatggagactacgactacattattttca
aattttgccaaatatggaaatccaaatggaaaaggagccaccgccgagatatgggagaaa
tacagcttaaaccgtccagagagacattacagaatttcttatccaaaatgtgaaatgaga
gatgtttatcacgagggtagaattcagtttttggagaaaatcgatggagatagtgataag
tatcaagaattggtctatggaaagaagaagtcggcaaagatttaa

DBGET integrated database retrieval system