KEGG   Caenorhabditis elegans (nematode): CELE_F13H6.3Help
Entry
CELE_F13H6.3      CDS       T00019                                 

Gene name
F13H6.3
Definition
Protein F13H6.3
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    CELE_F13H6.3 (F13H6.3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CELE_F13H6.3 (F13H6.3)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     CELE_F13H6.3 (F13H6.3)
    3.1.1.84  cocaine esterase
     CELE_F13H6.3 (F13H6.3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(6363513..6363720,6363764..6363893,6363940..6364593,6364670..6364914,6365048..6365136,6365187..6365273,6365369..6365527,6365576..6365668))
Genome map
AA seq 554 aa AA seqDB search
MGGFLSHLTPEQNVEALKASCGPVRGNIYKHDDVIVDGYLGIPYAKPPVGELRFKKPVTV
DVWTEIKDCYKYGPACVQTGGFEQIAGPRTPTPEEAGCLTLNVFTPRNASSEFKNGRPVM
VYIHGGGYELCASSDFCAYSLSGTLPLKDVVVVSINYRLGVFGFLTTGDNVCPGNFGLWD
QTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCD
FAIRASENQAKIFREFAEFHGFSGRDSSALFKWYQEQSPETLSNVKGYKKSISGFLTFIP
NLDGDFFPKPLDELRKEAPKKQMMTGVTEYEGLMLASMNPAFSPADVGLTLMPQGIYGKD
VVSNPDEIQKIFYEKYVEGVDKSDELAMRKKLCEALGDEFFNVGVIQAAKNAAKHGNEVY
FYTFEYVNPDSFGMWDGMMPFKAAVHCTELRYLLGEGVYSKFEPTEEDRKVMETTTTLFS
NFAKYGNPNGKGATAEIWEKYSLNRPERHYRISYPKCEMRDVYHEGRIQFLEKIDGDSDK
YQELVYGKKKSAKI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgggtggattcttgtctcatctgactcctgaacagaatgttgaagcattgaaagcttct
tgtggtcccgtaagaggaaacatttataaacatgatgatgtgattgttgatgggtacctc
gggatcccgtatgcgaaaccaccagtcggcgaacttcgatttaagaagccagtaaccgtt
gatgtttggacagagatcaaagattgttataaatatggaccagcttgtgtacagactggt
ggatttgagcagattgctggtccaagaactccaactccggaagaggctggttgtctcaca
ctgaatgtgttcacacccagaaatgcatcttctgaatttaaaaatggacgaccggttatg
gtttacattcatggaggaggatacgagttgtgcgcatcctctgatttctgtgcttactcc
ctttccggaactctcccacttaaagatgtcgtggtagtttctattaactaccgcctcggt
gtgtttggattcctcaccactggagacaatgtctgtcctggaaattttggtctttgggat
cagactttggctcttaaatgggttcaaaaacatatttcttcatttggaggtgatccaaat
tgtgtgactgtctttggacaaagtgcaggaggagcaagtactgatttattatcattgagc
ccacattcaagagatttgttccagcgcttcattccaatttccggaacggctcattgtgac
tttgccattagagcatctgaaaatcaagccaagattttccgagaatttgcagagtttcat
ggtttttctggaagagattcgtcagcactcttcaagtggtaccaagagcaatcgccagaa
actctgtcaaatgtaaaaggatacaaaaaatcgatttctggattcctcacattcattcct
aacttggatggagatttcttcccgaaaccattggatgagctaagaaaggaagctccaaag
aagcaaatgatgactggagttactgagtatgaaggtcttatgttagcatcaatgaatcca
gcattttctcctgctgatgtcgggttgacacttatgcctcaaggaatttatggaaaagat
gtggttagcaatccggatgaaattcagaagattttctatgaaaaatacgtcgaaggagtt
gacaaatcagatgagttggcgatgagaaagaaactatgtgaagctctcggagatgaattt
ttcaacgtaggagtgattcaggcagccaaaaatgctgccaagcatggaaatgaggtgtac
ttctacactttcgaatacgtgaatccagatagttttggaatgtgggatggaatgatgccg
ttcaaggctgctgttcattgcaccgagctcagatatcttctcggtgaaggagtttacagc
aagttcgaaccaacagaggaagatcggaaagttatggagactacgactacattattttca
aattttgccaaatatggaaatccaaatggaaaaggagccaccgccgagatatgggagaaa
tacagcttaaaccgtccagagagacattacagaatttcttatccaaaatgtgaaatgaga
gatgtttatcacgagggtagaattcagtttttggagaaaatcgatggagatagtgataag
tatcaagaattggtctatggaaagaagaagtcggcaaagatttaa

DBGET integrated database retrieval system