KEGG   Caenorhabditis elegans (nematode): CELE_F13H6.4Help
Entry
CELE_F13H6.4      CDS       T00019                                 

Gene name
F13H6.4
Definition
Protein F13H6.4
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    CELE_F13H6.4 (F13H6.4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CELE_F13H6.4 (F13H6.4)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     CELE_F13H6.4 (F13H6.4)
    3.1.1.84  cocaine esterase
     CELE_F13H6.4 (F13H6.4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(6366433..6366640,6366759..6366888,6366935..6367319,6367408..6367586,6367654..6367898,6367942..6368012))
Genome map
AA seq 405 aa AA seqDB search
MVFIHGGGFEFGGSADYCDYSLSGTLPLKDVVVVSINYRLGVFGFLTTGDSVCNGNFGLW
DQTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGSAYC
EFALRTSKSQAKIFREFAEFKGFTGGDSTTLLEWYKNQSSETLSDLRKEAPKKQMMTGVD
EYEGVIASMNPEFSPADAGLALFPKGVYGNDTAENPEEMHKLFYEKYVEGVDKSDDSAMK
KRLCEAFGDLGFNLGVFQSAKSSAKYGNDVFLYSFEYYHSDGFGMWKDLLPFEASMHGTE
LRYLLGEGFYSKFDATKEELEVLEKTTTLFSNFAKYGNPNGTGVTDEIWEKFNLNNPERH
FRISYPKCEMRDIFSGGRMPFLEKLEEKSLKTQELVYGTKKFTNN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggttttcattcatggaggtggcttcgaatttggcggttctgctgattattgcgattat
tcactttctggaacccttccccttaaagatgtcgtggtagtttctattaactaccgcctc
ggtgtatttggattccttaccactggagacagtgtttgcaatggaaatttcggtctttgg
gatcagactttggctcttaaatgggttcaaaaacatatttcttcatttggaggagatccg
aattgtgtgacagtttttggacaaagtgcaggaggagcaagtacggacttactatcactg
agcccacattccagagatttgttccaaagattcattccaatatctggctctgcttactgc
gaattcgctctcagaacatctaaaagtcaagccaaaatcttccgggaatttgcagagttc
aagggattcaccggcggagattcaactacacttttagaatggtataaaaatcagtcatcg
gaaactctctctgatctaagaaaggaagctccaaagaagcaaatgatgactggagttgat
gagtatgaaggtgtgatagcatcaatgaacccagaattttctcctgctgacgccggattg
gcattgtttcctaaaggagtatatgggaacgatactgctgaaaatccagaagaaatgcat
aaattattctatgaaaaatatgtggagggagttgacaaatctgacgattcagcaatgaaa
aagagactttgcgaagcttttggagatcttggattcaatcttggagtgttccagtcagcc
aagagttcagctaaatatgggaatgatgtgttcttgtattcatttgaatattatcattca
gatggttttgggatgtggaaagatcttctgccattcgaagcttctatgcatggaacagag
ctccgttatttgctcggcgaaggattctacagcaaatttgatgcaacgaaggaggaactg
gaggttcttgaaaaaacaaccacacttttttcaaattttgctaaatacggaaatccgaat
ggaacgggagttacggatgaaatttgggagaagtttaacttgaacaacccagaaagacat
tttcgaatttcgtatccaaaatgtgaaatgagagatatttttagtggtgggagaatgccg
tttttggagaagctcgaagaaaaaagcttgaagacccaggagctggtgtatggtacaaag
aaatttacaaataattga

DBGET integrated database retrieval system