KEGG   Caenorhabditis elegans (nematode): CELE_F17E9.9Help
Entry
CELE_F17E9.9      CDS       T00019                                 

Gene name
his-34
Definition
Protein HIS-34
Orthology
K11252  
histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:8335959..8336327
Genome map
AA seq 122 aa AA seqDB search
MPPKPSAKGAKKAAKTVTKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMN
SFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagccatctgcaaagggagccaagaaggccgccaagaccgtcaccaagcca
aaggacggaaagaagagacgtcatgcccgtaaggagtcatactctgtctacatctaccgt
gtcctcaagcaggttcacccagatactggagtctcctcaaaggctatgtccatcatgaac
tctttcgtcaatgacgtcttcgagcgtatcgccgctgaagcatctcgtcttgctcactac
aacaagcgttctaccatctcatcccgcgaaattcaaaccgctgttcgtttgattcttcca
ggagagcttgccaagcacgccgtgtctgagggaaccaaggccgttaccaagtacacttcc
agcaagtaa

DBGET integrated database retrieval system