KEGG   Caenorhabditis elegans (nematode): CELE_F17E9.9Help
Entry
CELE_F17E9.9      CDS       T00019                                 

Gene name
his-34
Definition
(RefSeq) HIS-34
  KO
K11252  
histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_F17E9.9 (his-34)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
IV:8335972..8336340
Genome map
AA seq 122 aa AA seqDB search
MPPKPSAKGAKKAAKTVTKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMN
SFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagccatctgcaaagggagccaagaaggccgccaagaccgtcaccaagcca
aaggacggaaagaagagacgtcatgcccgtaaggagtcatactctgtctacatctaccgt
gtcctcaagcaggttcacccagatactggagtctcctcaaaggctatgtccatcatgaac
tctttcgtcaatgacgtcttcgagcgtatcgccgctgaagcatctcgtcttgctcactac
aacaagcgttctaccatctcatcccgcgaaattcaaaccgctgttcgtttgattcttcca
ggagagcttgccaagcacgccgtgtctgagggaaccaaggccgttaccaagtacacttcc
agcaagtaa

DBGET integrated database retrieval system