KEGG   Caenorhabditis elegans (nematode): CELE_F23B12.5Help
Entry
CELE_F23B12.5     CDS       T00019                                 

Gene name
dlat-1
Definition
Protein DLAT-1
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CELE_F23B12.5 (dlat-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_F23B12.5 (dlat-1)
   00020 Citrate cycle (TCA cycle)
    CELE_F23B12.5 (dlat-1)
   00620 Pyruvate metabolism
    CELE_F23B12.5 (dlat-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CELE_F23B12.5 (dlat-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(14445574..14445703,14445753..14446205,14446273..14446999,14447059..14447272))
Genome map
AA seq 507 aa AA seqDB search
MSKFPVPLRTIGGLRPSTTAAISAANIGFTQSSRALSTGAAAKSSGLVGQVARQYPNAAA
FSIKQVRLYSSGNLPKHNRVALPALSPTMELGTVVSWQKKEGDQLSEGDLLCEIETDKAT
MGFETPEEGYLAKILIQEGSKDVPIGKLLCIIVDNEADVAAFKDFKDDGASSGGSAPAAE
KAPEPAKPAASSQPSPPAQMYQAPSVPKSAPIPHSSSGRVSASPFAKKLAAENGLDLSGV
SGSGPGGRILASDLSQAPAKGATSTTTQAVSGQDYTDIPLSNMRKTIAKRLTESKSTIPH
YYLTSEIQLDTLLQVREKLNGLLAKGTSGQATKISINDFIIKASALACQRVPEANSYWMD
SFIRENHHVDVSVAVSTPAGLITPIIFNAHAKGLATIASEIVELAQRAREGKLQPHEFQG
GTFTVSNLGMFGSVSDFTAIINPPQSCILAIGGASDKLVPDEAEGYKKIKTMKVTLSCDH
RTVDGAVGAVWLRHFKEFLEKPHTMLL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagttcccggtgccgttgagaacgattggtgggcttcgtccctcgacaacagca
gctatttctgccgccaacatcggtttcacacaatcgagtcgggccctcagcaccggagct
gccgccaaaagctcaggacttgttggacaagtagctcgccaatatccaaatgctgcagct
ttcagtattaaacaagttcgcctttatagcagtggaaatctgccaaagcacaatcgggta
gctctcccagcactttctccaactatggaactcggaactgttgtaagctggcagaaaaaa
gaaggagatcaacttagtgaaggagatttgctctgcgagattgaaaccgataaggccact
atgggattcgaaactccggaagaaggatatcttgccaagattctcatccaggaaggatcg
aaggatgttccaattggcaagcttctctgtattatcgtcgacaacgaggctgacgttgct
gccttcaaggatttcaaggacgatggtgcttcatctggtggatccgctccagcagccgag
aaagctccagagccagcaaaaccagccgcttcatcgcaaccatctcccccagcacaaatg
tatcaagcaccatcagttccaaagtccgcaccaattccacactcatcatcgggaagagtt
tctgcttcaccgttcgctaagaaacttgctgctgaaaatggccttgacttgagcggagtt
tctggaagtggaccaggaggacgtattctcgcttcggatctttcccaggctccagcaaag
ggcgctacttcaaccacaactcaagccgtatctggtcaagattataccgatattccactt
tcgaacatgcgtaagacaattgctaagagactcaccgaaagcaaatcaacgattccacat
tattatttgaccagcgaaattcaattggatacacttcttcaggttcgtgaaaagctcaac
ggtcttcttgcaaagggaacatcgggacaagccactaagatctcaatcaatgactttatc
atcaaagcttctgctcttgcatgtcaacgagttccagaagccaacagctattggatggac
tcgttcattcgtgagaatcatcacgtcgatgtttctgtagctgtcagcaccccagccggt
cttattactccaattatcttcaatgctcacgctaagggactcgccacgattgcctcagaa
attgtagaattggcgcaaagagcacgcgaaggaaaattgcagcctcatgagttccaagga
ggtactttcaccgtctcgaacctcggaatgttcggatctgtatctgatttcaccgcgatc
atcaacccaccacaatcatgcattttggctatcggaggagcatctgataagctggtccca
gacgaggctgaaggatataagaagattaagactatgaaggtaacattgtcatgcgatcac
aggactgttgatggagctgttggagccgtctggcttcgtcacttcaaggagttcctcgag
aagccacacacgatgcttctctaa

DBGET integrated database retrieval system