KEGG   Caenorhabditis elegans (nematode): CELE_F25G6.6Help
Entry
CELE_F25G6.6      CDS       T00019                                 

Gene name
asns-1
Definition
Protein ASNS-1
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_F25G6.6 (asns-1)
Enzymes [BR:cel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CELE_F25G6.6 (asns-1)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C44
   CELE_F25G6.6 (asns-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(8546266..8546418,8546469..8546558,8546621..8546693,8546738..8546869,8547030..8547476,8547525..8548158,8548370..8548496)
Genome map
AA seq 551 aa AA seqDB search
MCGIWAIIGEQVTPQQQDAFMKIVGRGPDLTVLEEVQPNVHLGFHRLAIVMPGDTPSAQP
IVGGGLSVVCNGEIYNHQSLKIDCPFTLKNGGSDCAAIITSFIKHNKDLKEACASLDGVF
AFIMADDKNVYIGRDPIGVRPLFYGYNSNGSLLIGSEVKCIEELCERVEYFPPGCCATIS
LFAPTRPVQPQQYYSVPTIADRFLSIDCTKTLVRDVLVKSVEKRLMGNRNFGFMLSGGLD
SSLIASIATRFLKQKPIAFSVGFEDSPDLENAKKVADYLKIPHEVLVITPQQCIDIIPEV
VFALETFDPLIIRCGIAHYLLCQHISKSSDVKVLLSGEGADELFGSYAYMQRAPNALHLH
KEILRRMHHLHQYDVLRCDRSTSCHGLEIRVPFLDKRFIDLVSRLPPSYKLMPMKLEKHV
LRSAFEGWLPDEVLWRSKEGFAEALGKTDLGDILAEHCDKLISKSLYERRAERFPDRTPE
TTEEYWYRQIFEDTFVYDKMGHLVHTKVYRTAAWHRPDEKENMHLETETLDVKTDDLLRL
RRRSTGSLGVA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatttgggccataataggcgaacaagtcaccccacaacagcaggatgcattt
atgaagattgtaggacgtggtccagatcttacagttttggaagaagttcaaccgaacgtt
cacctcggtttccatcgtcttgcaattgttatgcccggagatactccaagcgctcaacca
attgtcggcggcggtttgtctgtcgtctgcaacggagaaatctacaaccatcagtctctc
aagattgactgcccgttcacattgaaaaatggtggaagtgattgtgccgcgatcattacg
tcatttatcaagcacaataaagatcttaaagaggcttgtgcttcattggatggagtattt
gctttcattatggcagatgataagaacgtctacatcggaagagacccgattggagtcaga
ccacttttctatggatacaactcaaatggttcacttctcattggctcagaagtcaagtgt
attgaagaattgtgcgagagagttgaatattttccaccgggatgctgtgccactatcagc
ttgtttgcaccaactcgaccagttcaaccacaacaatattacagtgtcccaacaattgct
gaccgatttttaagcattgattgcaccaagacattagtccgtgatgttcttgtaaaatct
gttgagaaacgacttatgggaaacagaaattttggattcatgttgtcaggtggacttgat
tcttcattgattgcttcaattgccacacgttttttaaaacaaaaaccaattgctttttct
gttggattcgaagattcaccagatcttgagaacgcgaaaaaggtcgcagactatctgaaa
attccacatgaagttctcgtgatcaccccacagcaatgtattgatattattccagaagta
gtattcgctctggaaacatttgacccgctgatcatccgatgtggaattgcccactacttg
ctttgtcaacacatttcaaaaagttctgatgtgaaagttctgttatctggagagggagct
gatgaactttttggaagttatgcttatatgcaaagagctccaaatgcactccatcttcat
aaagaaatcctccgtagaatgcatcatctccaccaatatgacgtccttcgttgtgatcga
tccacttcttgtcacggactcgaaatccgagttccattccttgacaaacgattcatcgat
cttgtgagccgtcttccaccatcatataagcttatgcctatgaaattagaaaaacatgtt
ttgagaagtgcttttgaaggatggcttccggatgaagttctgtggagaagcaaagaaggt
ttcgccgaggctctcggtaaaactgatttgggagatattctcgctgaacattgtgataag
ctgatttcaaagagtttgtatgagcgtcgtgctgaaagattcccggacaggacaccagaa
acaacagaagaatattggtatcgccaaatttttgaggacaccttcgtctatgataagatg
ggacatttggtgcacactaaagtttatagaacggctgcctggcaccgacctgacgagaag
gagaatatgcacctagaaaccgagacattggatgtaaaaaccgatgatcttctccgacta
cgacgccgatcaactggatcacttggtgttgcctaa

DBGET integrated database retrieval system