KEGG   Caenorhabditis elegans (nematode): CELE_F26E4.12Help
Entry
CELE_F26E4.12     CDS       T00019                                 

Gene name
F26E4.12
Definition
Protein F26E4.12
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cel00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cel00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(9780340..9780407,9780464..9780550,9780995..9781331)
Genome map
AA seq 163 aa AA seqDB search
MSSVYDFNVKNANGDDVSLSDYKGKVLIIVNVASQCGLTNKNYTQLKELLDVYKKDGLEV
LAFPCNQFAGQEPSCEIDIQAFVADKFKFEPTLFQKIDVNGDKQSPLFKFLKNEKGGFMF
DAIKWNFTKFLVGRDGKIIKRFGPTTDPKDMEKDIKEALGEKL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggtttacgatttcaacgtcaaaaatgctaatggtgatgacgtgtcactttcg
gattacaaaggaaaagttctcattatcgtgaacgtcgcttcacagtgtggacttaccaac
aagaattatacacaactcaaagaattgctcgatgtgtacaaaaaggatggtctcgaagtt
cttgccttcccttgcaatcaatttgccggtcaggaaccatcgtgtgaaatcgatattcaa
gcatttgtcgctgacaaatttaaattcgaaccaacacttttccagaagattgatgtgaat
ggagataaacagtcaccacttttcaaatttttgaaaaatgagaaaggtggattcatgttc
gatgcaattaaatggaatttcacaaagttcttggttggacgcgatgggaaaattatcaag
agatttggaccaacgactgatccaaaggacatggaaaaagatatcaaagaagcacttgga
gagaaattgtaa

DBGET integrated database retrieval system