KEGG   Caenorhabditis elegans (nematode): CELE_F26E4.12Help
Entry
CELE_F26E4.12     CDS       T00019                                 

Gene name
gpx-1
Definition
Protein GPX-1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CELE_F26E4.12 (gpx-1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CELE_F26E4.12 (gpx-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CELE_F26E4.12 (gpx-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(9780349..9780416,9780473..9780559,9781004..9781340)
Genome map
AA seq 163 aa AA seqDB search
MSSVYDFNVKNANGDDVSLSDYKGKVLIIVNVASQCGLTNKNYTQLKELLDVYKKDGLEV
LAFPCNQFAGQEPSCEIDIQAFVADKFKFEPTLFQKIDVNGDKQSPLFKFLKNEKGGFMF
DAIKWNFTKFLVGRDGKIIKRFGPTTDPKDMEKDIKEALGEKL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggtttacgatttcaacgtcaaaaatgctaatggtgatgacgtgtcactttcg
gattacaaaggaaaagttctcattatcgtgaacgtcgcttcacagtgtggacttaccaac
aagaattatacacaactcaaagaattgctcgatgtgtacaaaaaggatggtctcgaagtt
cttgccttcccttgcaatcaatttgccggtcaggaaccatcgtgtgaaatcgatattcaa
gcatttgtcgctgacaaatttaaattcgaaccaacacttttccagaagattgatgtgaat
ggagataaacagtcaccacttttcaaatttttgaaaaatgagaaaggtggattcatgttc
gatgcaattaaatggaatttcacaaagttcttggttggacgcgatgggaaaattatcaag
agatttggaccaacgactgatccaaaggacatggaaaaagatatcaaagaagcacttgga
gagaaattgtaa

DBGET integrated database retrieval system