KEGG   Caenorhabditis elegans (nematode): CELE_F29F11.6Help
Entry
CELE_F29F11.6     CDS       T00019                                 

Gene name
gsp-1
Definition
Protein GSP-1, isoform B
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CELE_F29F11.6 (gsp-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CELE_F29F11.6 (gsp-1)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CELE_F29F11.6 (gsp-1)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CELE_F29F11.6 (gsp-1)
Spliceosome [BR:cel03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CELE_F29F11.6 (gsp-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(10682529..10682583,10682914..10683045,10683305..10683540,10684251..10684709,10685742..10685849)
Genome map
AA seq 329 aa AA seqDB search
MSNDGDLNIDNLITRLLEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLK
ICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDL
QNMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSE
KKAKYQYQGMNSGRPAVGGGRPGTTAGKK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgatggagatttaaacattgacaatctgatcaccagacttcttgaagttcgc
ggatgtcgtccaggaaagccagttaccatgtcggaggcggagatccgtgctctttgtcat
aaatctcgtgagatcttcctatcacagccaattcttctggaactcgaagcacctctcaag
atttgtggagacatacatggacaatataacgacttgctccgtttattcgaatacggagga
ttcccaccagaggccaattacttgttcctcggagattatgtcgatcgtggaaagcagagc
ttggaaacaatttgcttgttgctcgcatacaaagtcaaatatccagaaaactttttcctt
cttcgtggaaaccacgaatgtgcttcaattaaccgtatttatggattctacgatgaatgt
aagagacgtttttcgatcaaattgtggaaaactttcaccgattgcttcaactgtcttcca
attgctgcactcattgatgagaagatcttctgctgtcacggaggactctccccagatctc
caaaatatggaacaaattcgccgtgtgatgcgaccaaccgatgttcctgatactggattg
ttgtgcgatttgctctggtctgatccagacaaggatgttaccggatggggagaaaatgat
agaggagtctcgttcacatttggacctgatgtcgttgcaaagtttttgaacagacatgat
ttggatctgatatgcagagctcatcaggtcgtcgaagatggatatgagttctttgctaag
cgacaacttgtcacactattctctgctccaaattattgtggagaattcgataacgctggt
ggaatgatgagcgttgatgagacattaatgtgcagtttccagattctgaaaccatcggag
aaaaaagcgaaatatcagtatcaaggaatgaacagtggacgaccagcagtgggcggagga
cggcctggaacgactgctggtaagaagtaa

DBGET integrated database retrieval system