KEGG   Caenorhabditis elegans (nematode): CELE_F29F11.6Help
Entry
CELE_F29F11.6     CDS       T00019                                 

Gene name
gsp-1
Definition
Protein GSP-1, isoform B
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:cel03015]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(10682508..10682562,10682893..10683024,10683284..10683519,10684230..10684688,10685721..10685828)
Genome map
AA seq 329 aa AA seqDB search
MSNDGDLNIDNLITRLLEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLK
ICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDL
QNMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSE
KKAKYQYQGMNSGRPAVGGGRPGTTAGKK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgatggagatttaaacattgacaatctgatcaccagacttcttgaagttcgc
ggatgtcgtccaggaaagccagttaccatgtcggaggcggagatccgtgctctttgtcat
aaatctcgtgagatcttcctatcacagccaattcttctggaactcgaagcacctctcaag
atttgtggagacatacatggacaatataacgacttgctccgtttattcgaatacggagga
ttcccaccagaggccaattacttgttcctcggagattatgtcgatcgtggaaagcagagc
ttggaaacaatttgcttgttgctcgcatacaaagtcaaatatccagaaaactttttcctt
cttcgtggaaaccacgaatgtgcttcaattaaccgtatttatggattctacgatgaatgt
aagagacgtttttcgatcaaattgtggaaaactttcaccgattgcttcaactgtcttcca
attgctgcactcattgatgagaagatcttctgctgtcacggaggactctccccagatctc
caaaatatggaacaaattcgccgtgtgatgcgaccaaccgatgttcctgatactggattg
ttgtgcgatttgctctggtctgatccagacaaggatgttaccggatggggagaaaatgat
agaggagtctcgttcacatttggacctgatgtcgttgcaaagtttttgaacagacatgat
ttggatctgatatgcagagctcatcaggtcgtcgaagatggatatgagttctttgctaag
cgacaacttgtcacactattctctgctccaaattattgtggagaattcgataacgctggt
ggaatgatgagcgttgatgagacattaatgtgcagtttccagattctgaaaccatcggag
aaaaaagcgaaatatcagtatcaaggaatgaacagtggacgaccagcagtgggcggagga
cggcctggaacgactgctggtaagaagtaa

DBGET integrated database retrieval system