KEGG   Caenorhabditis elegans (nematode): CELE_F30F8.2Help
Entry
CELE_F30F8.2      CDS       T00019                                 

Gene name
glna-3
Definition
Protein GLNA-3
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_F30F8.2 (glna-3)
   00330 Arginine and proline metabolism
    CELE_F30F8.2 (glna-3)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CELE_F30F8.2 (glna-3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CELE_F30F8.2 (glna-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(7826491..7826853,7827276..7827522,7827850..7828130,7828472..7828563,7829072..7829582,7829787..7829934,7831417..7831526))
Genome map
AA seq 583 aa AA seqDB search
MDNKEKEDEELSDELKDQPGPSEKPRTPTVVAFTKPSFYRVNTVISDVKVCRSMSYDMCG
NHQQELLFDLYKDETTGKVYLPRFFKALLESGIRKDDPRIDKMIQNIKDADLLDDFVWGT
QHIYLEKDTFKRYIGSSIGVVTKALKKQMIIPDWERFVSDMGEIFEDVRSHNEGDLATYI
PQLSRVAPDSWAMSVCTIDGQRKMWGDALKPFCLQSVSKPFTYALVHDDIGPEELHAHVG
QEPSGRLFNDISLDHNKKPHNPLINAGAIVVASLLKNKLPLADRFDFMIHACRKFVGSGY
IGFDNSVFLSERETADRNYALSYYMREHKVFPKDLNLQDTLDLYFQICSIETNCDSLAVM
AATLANGGVNPMNGERIVNNRACRDTLSLMYSCGMYDWSGQFAFHVGLPAKSGVSGDMII
VIPNVMGIALYSPRLDKLGNTVRGVKFAEQLVQKYNFHNYDSLIYSDNKKIDPRRQLKDD
HDGQNRFMYATKLGDIAAIKRFLLMGHDIHCKDYDDRTVLHVAAAEGDVVTLEYVLSKWQ
EDPNPCDRYDRTPLDDAKHFNHTACVKLLEEAITVYNLKGQDD
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggataataaagaaaaagaagacgaagagctttccgacgagctcaaggatcagcctgga
ccgtcggagaagcctagaactccgacggttgttgcttttacaaaacccagcttctatcga
gtgaatacggtaataagtgatgtgaaagtgtgccgatcgatgtcttacgatatgtgtgga
aatcatcagcaggagctgttatttgatctctataaagatgaaactacaggaaaagtctac
ttgccaaggtttttcaaggcacttctagaaagcggaattcgaaaagatgatcctcgaatt
gacaaaatgattcaaaatataaaagatgctgatcttctcgatgattttgtttggggaact
caacatatttatttggaaaaagatacattcaaacgatacattggatccagcatcggagtt
gtaacaaaagctctcaaaaagcaaatgattattcctgattgggaacgatttgtgtctgat
atgggagaaatatttgaagatgttcgttcgcataatgagggtgatcttgccacgtatatt
ccacaattatcaagagttgcaccggatagttgggcaatgtctgtgtgtacaattgatgga
caacggaaaatgtggggtgatgcattgaaaccattctgcttgcaaagtgtatcaaaacca
tttacatatgctttagttcatgatgatattggacctgaagaacttcatgcacatgttgga
caagaaccttctggaagactttttaatgatattagtcttgatcacaataaaaagccacac
aatccactcatcaatgctggtgccattgtagtcgcttcacttctcaagaacaaactacca
cttgctgatcgatttgattttatgatccacgcatgccgaaaattcgttggcagtggctac
attggatttgataattctgttttcttgtccgaacgggaaacagctgatcgaaactacgca
ttatcgtactacatgagagaacacaaagtttttccaaaagatttaaatttacaagacact
cttgatctctattttcaaatttgttctattgaaacaaactgtgattcattggctgtgatg
gctgcaacattggcaaatggaggtgtcaatccgatgaatggagaacgaattgtgaataat
cgtgcttgccgtgatactctctcattgatgtactcttgtggaatgtacgattggtcgggg
cagttcgctttccacgtaggtcttccagccaaatcaggagtatctggagatatgattatt
gtgattccgaatgtgatgggtattgccttgtacagtccacgacttgataaacttggaaac
acggttcgaggtgtcaagtttgcagaacagctcgtacaaaagtataacttccataattat
gatagtctgatctactcggataataagaaaatcgatcctcgtcgtcaattgaaagatgat
catgacggtcagaatcgtttcatgtatgctacaaaattgggtgatattgctgcaattaaa
cgattccttttgatgggacatgatattcattgcaaagattatgatgatcgaacagtttta
cacgtggctgctgctgaaggagacgttgtcacattggaatacgtattgagtaaatggcaa
gaggatccgaatccatgtgatagatatgatagaactccattggatgatgctaaacatttt
aatcatactgcttgtgttaagctgctagaagaggcaattacggtttacaatcttaaagga
caagatgattag

  All links  
No link information was found.   
DBGET integrated database retrieval system