KEGG   Caenorhabditis elegans (nematode): CELE_F30F8.2Help
Entry
CELE_F30F8.2      CDS       T00019                                 

Gene name
glna-3
Definition
Protein GLNA-3
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cel00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cel00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cel00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(7826486..7826848,7827271..7827517,7827845..7828125,7828467..7828558,7829067..7829577,7829782..7829929,7831412..7831521))
Genome map
AA seq 583 aa AA seqDB search
MDNKEKEDEELSDELKDQPGPSEKPRTPTVVAFTKPSFYRVNTVISDVKVCRSMSYDMCG
NHQQELLFDLYKDETTGKVYLPRFFKALLESGIRKDDPRIDKMIQNIKDADLLDDFVWGT
QHIYLEKDTFKRYIGSSIGVVTKALKKQMIIPDWERFVSDMGEIFEDVRSHNEGDLATYI
PQLSRVAPDSWAMSVCTIDGQRKMWGDALKPFCLQSVSKPFTYALVHDDIGPEELHAHVG
QEPSGRLFNDISLDHNKKPHNPLINAGAIVVASLLKNKLPLADRFDFMIHACRKFVGSGY
IGFDNSVFLSERETADRNYALSYYMREHKVFPKDLNLQDTLDLYFQICSIETNCDSLAVM
AATLANGGVNPMNGERIVNNRACRDTLSLMYSCGMYDWSGQFAFHVGLPAKSGVSGDMII
VIPNVMGIALYSPRLDKLGNTVRGVKFAEQLVQKYNFHNYDSLIYSDNKKIDPRRQLKDD
HDGQNRFMYATKLGDIAAIKRFLLMGHDIHCKDYDDRTVLHVAAAEGDVVTLEYVLSKWQ
EDPNPCDRYDRTPLDDAKHFNHTACVKLLEEAITVYNLKGQDD
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggataataaagaaaaagaagacgaagagctttccgacgagctcaaggatcagcctgga
ccgtcggagaagcctagaactccgacggttgttgcttttacaaaacccagcttctatcga
gtgaatacggtaataagtgatgtgaaagtgtgccgatcgatgtcttacgatatgtgtgga
aatcatcagcaggagctgttatttgatctctataaagatgaaactacaggaaaagtctac
ttgccaaggtttttcaaggcacttctagaaagcggaattcgaaaagatgatcctcgaatt
gacaaaatgattcaaaatataaaagatgctgatcttctcgatgattttgtttggggaact
caacatatttatttggaaaaagatacattcaaacgatacattggatccagcatcggagtt
gtaacaaaagctctcaaaaagcaaatgattattcctgattgggaacgatttgtgtctgat
atgggagaaatatttgaagatgttcgttcgcataatgagggtgatcttgccacgtatatt
ccacaattatcaagagttgcaccggatagttgggcaatgtctgtgtgtacaattgatgga
caacggaaaatgtggggtgatgcattgaaaccattctgcttgcaaagtgtatcaaaacca
tttacatatgctttagttcatgatgatattggacctgaagaacttcatgcacatgttgga
caagaaccttctggaagactttttaatgatattagtcttgatcacaataaaaagccacac
aatccactcatcaatgctggtgccattgtagtcgcttcacttctcaagaacaaactacca
cttgctgatcgatttgattttatgatccacgcatgccgaaaattcgttggcagtggctac
attggatttgataattctgttttcttgtccgaacgggaaacagctgatcgaaactacgca
ttatcgtactacatgagagaacacaaagtttttccaaaagatttaaatttacaagacact
cttgatctctattttcaaatttgttctattgaaacaaactgtgattcattggctgtgatg
gctgcaacattggcaaatggaggtgtcaatccgatgaatggagaacgaattgtgaataat
cgtgcttgccgtgatactctctcattgatgtactcttgtggaatgtacgattggtcgggg
cagttcgctttccacgtaggtcttccagccaaatcaggagtatctggagatatgattatt
gtgattccgaatgtgatgggtattgccttgtacagtccacgacttgataaacttggaaac
acggttcgaggtgtcaagtttgcagaacagctcgtacaaaagtataacttccataattat
gatagtctgatctactcggataataagaaaatcgatcctcgtcgtcaattgaaagatgat
catgacggtcagaatcgtttcatgtatgctacaaaattgggtgatattgctgcaattaaa
cgattccttttgatgggacatgatattcattgcaaagattatgatgatcgaacagtttta
cacgtggctgctgctgaaggagacgttgtcacattggaatacgtattgagtaaatggcaa
gaggatccgaatccatgtgatagatatgatagaactccattggatgatgctaaacatttt
aatcatactgcttgtgttaagctgctagaagaggcaattacggtttacaatcttaaagga
caagatgattag

DBGET integrated database retrieval system