KEGG   Caenorhabditis elegans (nematode): CELE_F31B12.1Help
Entry
CELE_F31B12.1     CDS       T00019                                 

Gene name
plc-1
Definition
Protein PLC-1, isoform C
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CELE_F31B12.1 (plc-1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    CELE_F31B12.1 (plc-1)
   04070 Phosphatidylinositol signaling system
    CELE_F31B12.1 (plc-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CELE_F31B12.1 (plc-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(10795070..10795207,10796510..10796655,10796984..10797077,10797180..10797307,10797362..10797548,10798203..10798289,10798408..10798644,10798695..10798791,10799045..10799376,10799425..10799697,10800071..10800370,10800415..10800567,10800615..10800840,10801155..10801260,10801305..10801542,10801623..10801733,10802923..10803150,10805636..10805756,10806193..10806286,10806335..10806474,10806633..10806846,10807000..10807265,10807494..10807572,10807964..10808102,10808152..10808301,10808350..10808532,10808656..10808891,10809062..10809187,10809232..10809523,10809644..10809853,10809914..10810194,10812459..10812534))
Genome map
AA seq 1895 aa AA seqDB search
MNWDTLKGVLKTRRLTKRTIPAYIHPTSRSDSTSSTQSATAGFILNEEPITLFRLELERL
QYILHFPEEVAFQLSSTEYQLFYSIQPMDYVRYVSCDLTSVPVSENPSPVRNLVKRLSEV
SSWITHVIVSQPTHDDRKVALTAILRIVETCWNIGNFNAAVEVLMGLKSEKLRPFWLSLR
QEEKSQFDSLCETLLPANQALPSQAYINAVQRALRMPQSRVIPFFGIFLRDLYAIVNDLP
NIVVIGQEGETQKLEFMSDPNGEDHFSSRIGVGGLLNADKINLVAIVLDNLELFHRHSRT
MIKLLEEQAVPPIQIPQNEREQKEKEAKTYEPVQVVRGSSHGVALIPLDTLTFDLDVIQR
LQHGTTVIHYEPDSGRSNLCLLRLDPSCGQINWHKISYSVNKDPKEKDVLAKVSVSNLQP
LDSGRGAPSPMPSGRTPGTGGVGVEEGELKLSVVKGVELVDSYDIDIEAIYRRHSMEEMS
VPVSCWKVSHGQLLSDNEFIYFLAPQQIAQFWTNGLQSVVKSLQGQQRYPDRRMLWIKNV
YLSLYEITGESNCGPRPFEALQAFGLSQTNTNATRPNDSSLSSEPGGAKSRLKNLKNAMQ
KKLRGASREGSRSQSPQPHSPLVRPPSIKSQISSQSGPPGPNSPGYLLKPRGEPANSDAG
DIDSIYTPRSRTPTSSSYGGRSVGGRSCKSWRSRGGETPNSGSISSSGQMSIQVSGLSGP
SGKEFQEKPLTLVEFAELFRLFNTRMRKDLRDVFNDVLSTATTPQHCPKRERDRHSPRMQ
SRLASVSNSYNADFLSNDFLTRNTAVTSHHISEKQNKIYNALALASVNSMGGLMDTSRSS
MLTPQMLRAFVNTHQMEQIDEQTAIKLIQDHEPDGICRQKNQMSFEGFTRFLCDPVNFAF
VPETIEPDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWD
GDDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFK
TVLGDLLVSNFLFEADFSDSPRLPCPLQMKNKILIKNKKMIVDPPTPLPMIERGAVQRGE
TQLNLHRKQSKNSYESSTVDEVEDDDLDEFLDDEENEEDDQEEVQVRSEKEDSPKTSKRA
EKSARNIKQQDSLCSDHSVEQAKPSTSKTTSKTNDRKTEDEVLYAQLAQNAIRNQQPRKN
NTGVQIAPELSDIVIYMQATKFKGFPPVDGIQSPRIMEEGPASASLSFSSRARTPSNLLN
TPAPPRRQRSSTQLSQELAAEFLGSVRANATATCYQVTSLNENAAKKLMKRHPAKCVSYT
RDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQL
KPRCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHVYPNTHYASLYVEIEVIGIH
NDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNGRVVAHRVVPVKCI
RPGFRHLPLRTPTNLPIDNAMIFLRTRFEQEEHIYLHDDDSNTYCNLEHTLAYRTDLTPN
LSPTPILKKQIFVLRITGAFADETAITVHSESGSTVKTVMQQALLNAGKNADQVEEYVLI
EESLPAPSGEDPIEQRVLPLNEPIMDAVACWNGSMRRFVLRKKGSDPSSRAWITSIIKSG
TSGSSTSVSPSPLTKDGHVKSASSNQLHGRSLDTDAFGEHLEVTEGKWLNPRARSMGDTF
LVCVHNVSEDQPYAILRAGIHSTAADIIRQVFVKARRSNVDDSEFVLVEETCDDPKLNQG
QMTPKYPNNRTTSRVLGQNENVWKAQSRWKSMGRFVLENRKDTVHATLEKGRRVESTTSS
STTTRKISLSSVRSIGLPRKFSKFGKSLTMDAGPK
NT seq 5688 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggacactctgaaaggcgtgctgaaaacaaggcgtttgacaaaacgtacgatt
ccagcgtatattcatccaacatcacgtagtgactcaacctcttcaacgcaatcagccaca
gctggattcattctcaatgaagaaccaatcacactgttccgacttgaactcgaacgactt
caatatattcttcatttccctgaagaagttgcattccaactatcttctactgagtatcag
cttttctactcaatacaacccatggattatgttcgttacgtcagttgcgatctcacatct
gttccagtgtcagaaaatccaagtccagtgcgaaatcttgtgaaaaggctatcagaggta
tcatcctggataacacatgttattgtcagtcagccaacacatgacgatcgaaaggttgct
cttactgcaattttgagaattgtggaaacttgctggaatattggaaactttaatgcagct
gttgaggttcttatgggtttaaagagtgaaaaactcagaccattctggctttctttgcga
caagaggaaaagtctcagtttgattcgctttgcgaaaccttgcttcctgcaaaccaagct
ctcccatctcaagcttacatcaacgcggtccaacgagcactgagaatgccacaatctcgt
gtgattccattttttggaatatttcttcgtgatctctacgcaattgtgaatgacttgccg
aatatcgttgtgattggacaagaaggtgaaacccaaaagctggaattcatgagcgatccc
aatggcgaagatcatttttcgtcgagaattggagtgggtgggctgttgaatgctgataaa
atcaacttggtggcaattgttttggacaacttggaattattccatcgtcacagcaggaca
atgatcaaattgttagaagagcaagcagtcccaccaattcaaattcctcagaacgagcgg
gagcaaaaagaaaaggaagcaaaaacatatgaaccagtacaagtggttcgcggctcttct
catggagtggctctcatccctcttgataccctaacattcgatcttgatgttatccaacga
ctccagcacggaacaacagtgatccattacgaacctgattcgggaagaagcaatttgtgt
ctgctgcggttagaccctagttgcggtcaaataaactggcataagatttcatattcagtt
aacaaagatcccaaagaaaaggatgtgctcgccaaagtatccgtttcaaatctgcagccg
ctagactctggccgaggggctccgtcaccaatgccatctggaagaacaccaggaactgga
ggagttggagtagaggagggagaactcaaattaagtgttgtgaaaggagtcgaactagtt
gatagttatgatattgatattgaggcaatttaccgtcgtcattctatggaagagatgtca
gttcctgttagctgttggaaagttagtcatggtcagttgttatcggataatgagttcatc
tactttttggcccctcaacaaattgctcaattttggaccaacgggttgcaatctgtagtt
aaaagtctccaaggacagcaaaggtaccctgatcggcgaatgttatggatcaaaaatgtc
tacttatcactttacgagataacgggcgaatcaaactgtggaccacggccatttgaagca
cttcaggcatttgggctgagtcaaacaaatactaacgcaacacgacccaatgactcgtcg
ctgtccagtgagccaggaggagctaaaagcagactgaagaaccttaaaaatgctatgcaa
aagaagcttcgtggtgcatcgcgcgaaggaagcagatctcagtcacctcaacctcattct
cctcttgtccgaccaccatcaataaaatcgcaaatatcgtcacaatctggtccgccgggt
ccgaactctccaggctatttgctgaaaccacgtggagaacctgccaatagtgatgcagga
gacattgatagcatttatacacctcgatcaagaactccaacaagcagctcctatggaggg
cgatccgttggagggagatcatgtaaatcgtggagatcaagaggaggagagacaccaaat
tcgggttccataagcagctcgggtcagatgtcaattcaagtgtctggtctgagtggacca
tcgggaaaagagtttcaggaaaaaccattaacacttgtagagttcgctgaactttttcga
ttgttcaatacaagaatgagaaaagatttgagagatgtgttcaatgatgtcctgtctacg
gcaactactcctcagcattgtcctaaaagagaacgtgatcgccacagtccgagaatgcag
tcaaggctggcgagtgtctccaactcgtacaatgcagattttctgtctaacgatttcttg
actcggaatacggcagtaacgtcccatcatatcagtgaaaagcaaaacaaaatctacaat
gcattggcacttgcgagtgttaatagcatgggcggactcatggacacttcccggtcgtcg
atgctgacgccgcaaatgctgcgcgcttttgtcaacactcatcagatggagcagattgac
gagcaaacggcgattaagcttattcaggatcatgaacctgatggtatctgtcgacaaaag
aatcaaatgtcattcgaaggattcactagattcctttgcgatcctgtcaactttgcattc
gtaccggaaacaattgaaccagatgaagaggacctacggtacccgttgtctcattattac
atcaattcaagtcacaacacctatttgacgggacatcaactcaagggacccagtagctcg
gagatgtacagacaggttctcctcaccgggtgtcggtgtgtcgagcttgattgttgggat
ggagatgacggattgccattgatttatcatggacacacattggttagcaagattgggttt
agacaggtggtcgaaattatcaaaaaatctgcattcataacatcggatcttcctgtgata
ttatcaattgagaatcattgttccctacaacaacaggcgaaaatggcacagatgttcaaa
acagttcttggagatttactagtatcaaacttcctttttgaagctgatttctcggactct
ccacgtcttccatgccctctccaaatgaaaaataagatcttgataaaaaataagaaaatg
atagtcgacccaccaactccattgccaatgattgaacgaggagctgtgcagcgtggtgaa
actcaattaaatcttcacagaaaacagagtaaaaactcctacgaaagcagtacggtagat
gaagtggaagatgacgacctagatgagtttcttgacgatgaagaaaatgaggaggatgac
caagaagaggttcaagtcagaagtgaaaaagaagacagtccgaagacatcaaaacgtgca
gagaaatcggctagaaacatcaaacagcaagattcgttatgtagcgatcattcggtagag
caggcaaaaccttccacaagcaagaccacatccaaaaccaacgatagaaagactgaagat
gaagtactttacgctcaacttgctcaaaatgccatccgaaaccaacaaccaagaaagaac
aatactggagtccaaatagcgccagagttgtcagatattgtcatttacatgcaagcgaca
aaattcaaaggatttcccccagtcgatggcattcaatcaccaaggataatggaggaaggg
ccagcttctgcaagtctttcattttcatcacgggctcgtacgccatcaaatctgctgaat
acaccagcccctccacgacgacagcgaagtagcactcagttgagtcaagaactggctgca
gaatttttgggatcagttagggcaaatgctacagctacatgctaccaggttacatctctt
aatgaaaacgctgcaaagaaactgatgaaaagacatccagcaaaatgcgtatcttatact
cgggaccatctgattcgtacgtatccaagtgccaagcactatgactcgtccaactttaac
cccatcaactgctgggctcatggaatgcaaatggttgctttaaattttcaaactcctgat
gttataatggcagttaaccaagcgatgttcgagcaatctggaaactgtggatatcaactg
aaaccacgttgtctttgggatgaatctcatcttttgtacaacaaatttttgcctctctcc
aaagacattgccggccattctgctttgttactaaacttaactattatatccggacagcac
gtgtatccaaacacccattacgccagtttatatgtcgaaattgaagtcatcggtattcac
aacgactgtgttcgtgagaaatcaaaagtggtccagagaaattctgtgaatccaatctgg
aaccacaccactcaacttcgaatagcttgtgttgacttagcattccttcgcatagcagta
tgtgatagtgggcaaaatggaagagtcgttgctcaccgagttgttcctgtcaaatgcatt
cgtccgggtttccgacatctcccactcagaactccaactaatcttccgatcgacaacgct
atgatatttttaagaacaagattcgagcaagaagaacacatctacctccacgacgatgat
tcaaacacctattgtaatctagaacatacgctggcataccgcacagacttaacacccaat
ttatctccaacgccaattttgaagaaacagatctttgttcttcgaattacaggcgcgttt
gctgatgaaacagcaattacagtgcacagcgagtcaggaagtacagtgaagacggtgatg
caacaggcgctgcttaacgctggaaagaatgcggatcaggttgaagagtatgtactcatc
gaagaatcactgccggcaccttctggggaagatccaattgagcagagagtacttcctctg
aacgagcctatcatggacgccgtggcctgctggaacggttcaatgcgtcgttttgtgtta
cgaaaaaaaggcagtgacccatcatctagagcttggatcacttcaattataaaatccgga
acaagtggaagctccacgtcagtctcaccaagtccgttgaccaaagatggacacgtaaag
agtgcatcaagcaatcaacttcatggacgatcattggacactgacgcttttggagagcac
cttgaagtgacagaaggcaagtggttgaaccctcgtgcaagatcaatgggcgacacattt
ctggtatgtgttcacaatgttagtgaagatcagccttatgcaatcctacgtgctggaatc
cacagcactgccgccgacattattcgtcaggtgtttgttaaagctcgccgttcaaatgta
gacgattccgagtttgttcttgttgaagaaacctgcgatgatccaaaactcaatcaaggc
caaatgactccaaagtatccaaacaaccgcaccacaagccgagtgttaggacaaaacgaa
aatgtttggaaagcacaatcgaggtggaagtcaatgggcagatttgtacttgaaaaccga
aaggacacagtgcacgcaaccctcgaaaaaggtagacgtgtggaaagcacaacttcttcc
tccaccacaacgcgcaaaataagtttatccagcgttcgctcaatcggtcttccacgtaaa
ttctccaagtttggcaagtcgttgactatggatgctggaccaaagtga

DBGET integrated database retrieval system