KEGG   Caenorhabditis elegans (nematode): CELE_F32G8.6Help
Entry
CELE_F32G8.6      CDS       T00019                                 

Gene name
cat-4
Definition
Protein CAT-4
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CELE_F32G8.6 (cat-4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CELE_F32G8.6 (cat-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(10564914..10565076,10565644..10565739,10565787..10565984,10566043..10566257)
Genome map
AA seq 223 aa AA seqDB search
MSRIENESGFLSSDAASVGSEDDKVEMKKRNGTIPKEDHLKSMCNAYQSIIQHVGEDINR
QGLLKTPERAAKAMMAFTKGYDDQLDELLNEAVFDEDHDEMVIVKDIEMFSLCEHHLVPF
MGKVHIGYIPNKKVLGLSKLARIVEMFSRRLQVQERLTKQIATAMVQAVQPSGVAVVIEA
SHMCMVMRGVQKINASTTTSCMLGVFRDDPKTREEFLNLINKR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaattgagaacgaaagcggatttttgtcatctgacgccgcaagtgttggatcc
gaagacgataaagttgagatgaagaaaagaaacggaacgattccaaaggaagatcatttg
aaatcaatgtgcaatgcctatcagagcatcattcaacatgtcggagaagacatcaatcgt
cagggacttctgaaaactccagaacgtgctgccaaagcaatgatggcattcacaaaggga
tacgatgatcaacttgatgagctcctcaacgaggcagtattcgacgaggatcacgatgag
atggttattgtgaaagatattgaaatgttctccctttgtgagcatcatttagttccattt
atgggaaaagttcatattggatacattccaaacaagaaggttcttggtctgtccaagttg
gcaagaatagtcgagatgttcagcagaagacttcaagtccaagaacgtcttacaaagcaa
attgccaccgcaatggttcaagctgtacaaccatccggagttgcagttgttattgaagct
agtcacatgtgtatggtaatgagaggagttcaaaagatcaatgcttccaccacaacatcc
tgcatgttgggagtattccgtgacgatccaaagactcgcgaagaattccttaatcttatc
aacaaacgctaa

DBGET integrated database retrieval system