KEGG   Caenorhabditis elegans (nematode): CELE_F32G8.6Help
Entry
CELE_F32G8.6      CDS       T00019                                 

Gene name
cat-4
Definition
Protein CAT-4
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cel00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(10564891..10565053,10565621..10565716,10565764..10565961,10566020..10566234)
Genome map
AA seq 223 aa AA seqDB search
MSRIENESGFLSSDAASVGSEDDKVEMKKRNGTIPKEDHLKSMCNAYQSIIQHVGEDINR
QGLLKTPERAAKAMMAFTKGYDDQLDELLNEAVFDEDHDEMVIVKDIEMFSLCEHHLVPF
MGKVHIGYIPNKKVLGLSKLARIVEMFSRRLQVQERLTKQIATAMVQAVQPSGVAVVIEA
SHMCMVMRGVQKINASTTTSCMLGVFRDDPKTREEFLNLINKR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaattgagaacgaaagcggatttttgtcatctgacgccgcaagtgttggatcc
gaagacgataaagttgagatgaagaaaagaaacggaacgattccaaaggaagatcatttg
aaatcaatgtgcaatgcctatcagagcatcattcaacatgtcggagaagacatcaatcgt
cagggacttctgaaaactccagaacgtgctgccaaagcaatgatggcattcacaaaggga
tacgatgatcaacttgatgagctcctcaacgaggcagtattcgacgaggatcacgatgag
atggttattgtgaaagatattgaaatgttctccctttgtgagcatcatttagttccattt
atgggaaaagttcatattggatacattccaaacaagaaggttcttggtctgtccaagttg
gcaagaatagtcgagatgttcagcagaagacttcaagtccaagaacgtcttacaaagcaa
attgccaccgcaatggttcaagctgtacaaccatccggagttgcagttgttattgaagct
agtcacatgtgtatggtaatgagaggagttcaaaagatcaatgcttccaccacaacatcc
tgcatgttgggagtattccgtgacgatccaaagactcgcgaagaattccttaatcttatc
aacaaacgctaa

DBGET integrated database retrieval system