KEGG   Caenorhabditis elegans (nematode): CELE_F35G12.1Help
Entry
CELE_F35G12.1     CDS       T00019                                 

Gene name
mlcd-1
Definition
Protein MLCD-1, isoform A
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CELE_F35G12.1 (mlcd-1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CELE_F35G12.1 (mlcd-1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CELE_F35G12.1 (mlcd-1)
Enzymes [BR:cel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     CELE_F35G12.1 (mlcd-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(4566410..4566500,4566548..4566653,4566701..4566913,4566963..4567118,4567165..4567340,4567386..4567612,4567661..4567783,4567832..4567966,4568016..4568117))
Genome map
AA seq 442 aa AA seqDB search
MLRRYSHFYSIRYSSTLLSTLDGLTNRTSGDKLLTYSEKFSKLYANSTPETRKSIFVDLV
TNYGVNKEALNHAISLYSKNDQMYPEVRTSATASYVNLIKSIGNLPGGVMQVCEMRANIL
ALLKRETDKTTTSYLRHIELATREVLTSWFSLGNLKLERLTWSSPGDILQKVAEYEAVHP
VRGLSDFRKRLGPLRRCFYFSHEALPRNPLVMVHVALVDEIADSVQEITKRGAPTGKEED
QTTAIYYSITSTQPGLSGIDLGNMLIKKVATKLQKDVPSVTTHSTLSPIPGFRPWLIRNL
KGNSEYPSIMNEKVVNWISDISEREMNEVEATETLLKVISNEKTKKEQLNAIQHILMYAC
AHYLCNAKRNGMALNSVANFHIRNGAELYRLNWNGDTSHRGINNSFGIMVNYRYDLEKVH
ENSAAYTEHKKMAINQKVLDIF
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtcgatattcacatttttactcgattcgatattcttccacattattatctact
ttagacggactcacaaatcgaacaagtggagataagttactcacttatagcgagaagttt
tccaaattatatgccaattccacgccagaaactcgaaaatcgattttcgtagatctcgtc
acaaactatggtgtaaacaaagaagccctaaatcatgcgatttctctatattctaagaat
gatcaaatgtacccggaagtaagaacatcagcaacagcttcttatgtgaatttgataaaa
tcaattggaaatttaccgggaggagttatgcaagtctgtgaaatgagggctaatattttg
gcacttctaaaacgggaaactgacaaaactacaacatcatatctccgtcacattgaactg
gccactagagaagtattaacttcatggttttctttaggaaatctaaaattggaacgactt
acgtggtcatctcctggagatattctacagaaagtcgccgaatatgaggcagttcatcca
gttagaggactttcagatttcagaaaacgtcttggtccgttgagacgatgtttctatttt
tcccacgaagctcttccccggaacccacttgtgatggttcacgtggcattagttgatgag
atagcggatagtgtacaagaaatcacaaaaagaggagcaccgactggaaaagaagaagat
caaacaactgcaatttattattcaatcacttctacacagcctggtctttctggtattgat
ctcggaaatatgctcatcaagaaagtcgccactaaacttcaaaaagatgttccatcagtc
acaactcattcaacattatctccgattcctggtttccgaccttggcttatcagaaatctg
aaagggaattcagaatatccttcaattatgaatgaaaaggttgtcaattggatttctgat
atatctgaaagggaaatgaacgaagtagaagcaaccgaaactctactgaaagtcataagc
aatgaaaaaacgaaaaaggagcagctcaatgcaatccagcacattttgatgtacgcgtgt
gctcattatctttgtaatgcaaaacgaaatggaatggctttaaattcagttgcaaacttc
cacattagaaacggcgcagagttgtatagactgaattggaatggagatacgagtcataga
gggatcaataacagttttggaattatggtaaactacagatacgatttggagaaggttcac
gagaacagtgcagcttacactgaacacaaaaagatggcgattaatcagaaagttttggat
atcttctga

DBGET integrated database retrieval system