KEGG   Caenorhabditis elegans (nematode): CELE_F35G12.1Help
Entry
CELE_F35G12.1     CDS       T00019                                 

Gene name
mlcd-1
Definition
Protein MLCD-1, isoform A
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cel00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cel00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:cel04146]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(4566378..4566468,4566516..4566621,4566669..4566881,4566931..4567086,4567133..4567308,4567354..4567580,4567629..4567751,4567800..4567934,4567984..4568085))
Genome map
AA seq 442 aa AA seqDB search
MLRRYSHFYSIRYSSTLLSTLDGLTNRTSGDKLLTYSEKFSKLYANSTPETRKSIFVDLV
TNYGVNKEALNHAISLYSKNDQMYPEVRTSATASYVNLIKSIGNLPGGVMQVCEMRANIL
ALLKRETDKTTTSYLRHIELATREVLTSWFSLGNLKLERLTWSSPGDILQKVAEYEAVHP
VRGLSDFRKRLGPLRRCFYFSHEALPRNPLVMVHVALVDEIADSVQEITKRGAPTGKEED
QTTAIYYSITSTQPGLSGIDLGNMLIKKVATKLQKDVPSVTTHSTLSPIPGFRPWLIRNL
KGNSEYPSIMNEKVVNWISDISEREMNEVEATETLLKVISNEKTKKEQLNAIQHILMYAC
AHYLCNAKRNGMALNSVANFHIRNGAELYRLNWNGDTSHRGINNSFGIMVNYRYDLEKVH
ENSAAYTEHKKMAINQKVLDIF
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtcgatattcacatttttactcgattcgatattcttccacattattatctact
ttagacggactcacaaatcgaacaagtggagataagttactcacttatagcgagaagttt
tccaaattatatgccaattccacgccagaaactcgaaaatcgattttcgtagatctcgtc
acaaactatggtgtaaacaaagaagccctaaatcatgcgatttctctatattctaagaat
gatcaaatgtacccggaagtaagaacatcagcaacagcttcttatgtgaatttgataaaa
tcaattggaaatttaccgggaggagttatgcaagtctgtgaaatgagggctaatattttg
gcacttctaaaacgggaaactgacaaaactacaacatcatatctccgtcacattgaactg
gccactagagaagtattaacttcatggttttctttaggaaatctaaaattggaacgactt
acgtggtcatctcctggagatattctacagaaagtcgccgaatatgaggcagttcatcca
gttagaggactttcagatttcagaaaacgtcttggtccgttgagacgatgtttctatttt
tcccacgaagctcttccccggaacccacttgtgatggttcacgtggcattagttgatgag
atagcggatagtgtacaagaaatcacaaaaagaggagcaccgactggaaaagaagaagat
caaacaactgcaatttattattcaatcacttctacacagcctggtctttctggtattgat
ctcggaaatatgctcatcaagaaagtcgccactaaacttcaaaaagatgttccatcagtc
acaactcattcaacattatctccgattcctggtttccgaccttggcttatcagaaatctg
aaagggaattcagaatatccttcaattatgaatgaaaaggttgtcaattggatttctgat
atatctgaaagggaaatgaacgaagtagaagcaaccgaaactctactgaaagtcataagc
aatgaaaaaacgaaaaaggagcagctcaatgcaatccagcacattttgatgtacgcgtgt
gctcattatctttgtaatgcaaaacgaaatggaatggctttaaattcagttgcaaacttc
cacattagaaacggcgcagagttgtatagactgaattggaatggagatacgagtcataga
gggatcaataacagttttggaattatggtaaactacagatacgatttggagaaggttcac
gagaacagtgcagcttacactgaacacaaaaagatggcgattaatcagaaagttttggat
atcttctga

DBGET integrated database retrieval system