KEGG   Caenorhabditis elegans (nematode): CELE_F35H8.6Help
Entry
CELE_F35H8.6      CDS       T00019                                 

Gene name
ugt-58
Definition
(RefSeq) Putative UDP-glucuronosyltransferase ugt-58
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CELE_F35H8.6 (ugt-58)
   00053 Ascorbate and aldarate metabolism
    CELE_F35H8.6 (ugt-58)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CELE_F35H8.6 (ugt-58)
   00860 Porphyrin and chlorophyll metabolism
    CELE_F35H8.6 (ugt-58)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CELE_F35H8.6 (ugt-58)
   00982 Drug metabolism - cytochrome P450
    CELE_F35H8.6 (ugt-58)
   00983 Drug metabolism - other enzymes
    CELE_F35H8.6 (ugt-58)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CELE_F35H8.6 (ugt-58)
Glycosyltransferases [BR:cel01003]
 Others
  Hydrophobic molecule
   CELE_F35H8.6 (ugt-58)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
II:complement(join(9584494..9584806,9584876..9585321,9585376..9585534,9585585..9585799,9585913..9585977,9586022..9586143,9586196..9586306,9586607..9586777))
Genome map
AA seq 533 aa AA seqDB search
MKSWLLLLGTIGWVTAGDVLFIPSTLYPVHAQTMSVLARELAERGHKVTWLEIGPERSDI
VLHQQVSREFWPAQFGDRTLQEIYQFKNHTSHSELWNPQYTNENEQTTGWLASIRLCDSV
LSRSKSKFDKMVEKQFSTVIVDDLYNSCGVLMAGLKKSVYIYWSMTGLRTESAWANQSPS
PPSYLPVAGTGLTDDLTFSQRLYNVASYFKQLYIHQHIVQPRIDAVFQKYYPGVESTFEI
ERNASINFVNTPPIFDFSRPYMPRVNFIGAIQCRKPKELPKEFTSWISAYPDGFVVLSTG
FTVQWNKSPEHIRQAYLDTFKYLPNLLFIWQTGLPNSSNLPSNLLVKPWLPLQDLLGHQK
CRCHVSHGGLNSVIESVYHGVPVVGVPLTSRGYDNLLRITARDSGVMVEKSEFSGEILTA
AINEVIENEKYKKEMLIFQDMVIDVPYTELYHAAFWVEFIERHQEVPHARSGADHLNFLQ
YFLVDVIAFFFFVIFCTLSIIYYTIRTVFRTIRSVVNGVRGVPKIVSRGKKNN
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttggcttctattgcttggaacaataggttgggtaaccgctggagatgttctt
ttcattccaagtacattatatccagtccatgcccagacaatgtcagttcttgcaagagag
ttggctgaacgaggacacaaagtgacatggctggaaattggcccagaaaggtccgacatc
gtacttcatcagcaagtatctcgcgaattctggcctgcacaatttggagatcgaactctc
caggaaatttatcaattcaaaaatcatacgtcacattccgagctttggaatccacaatat
acaaatgaaaatgagcaaactactggctggctggcatcaattcgtctctgtgattcggtt
ttgtctcggagcaagagtaaattcgataaaatggttgagaaacaattttctaccgtaatc
gttgacgacttatataattcatgtggagttttgatggcaggattgaaaaaatccgtctac
atctattggtccatgactggtctccgcaccgaatccgcgtgggccaaccagtctccatct
cctccaagttatctcccagttgccggcactggactcactgatgatttaactttctcgcaa
cgtctttacaacgtggcatcctatttcaaacaactgtatattcatcaacatattgtgcaa
ccaagaattgatgcagttttccagaaatactacccaggagtcgagtctactttcgaaatt
gagcgcaacgcatctataaacttcgtgaatacccctcctatttttgacttctcaagacca
tacatgccacgtgtaaatttcatcggagccatccaatgcagaaaaccaaaagaacttccg
aaggagtttacctcttggatctcagcctatcctgacggtttcgttgtgctctccactggg
ttcactgttcaatggaacaaatctccggagcacattcgtcaagcctatctggataccttc
aagtatcttccaaatctcttgttcatttggcaaactggtctaccaaattcttcaaacttg
ccatcaaatctactcgtcaagccatggcttccacttcaagacctactaggtcatcaaaag
tgccgatgccacgtgtcacatggaggattgaacagtgtcattgaatcagtttatcacgga
gttccagttgttggagtaccattgacttctcgtggttatgataatttactgagaatcact
gcacgagatagtggagtcatggtggagaaatcggagttcagtggggaaatattgactgcc
gctattaatgaagtgattgaaaatgagaaatacaagaaggaaatgttaatcttccaagat
atggtcatcgatgttccatacactgaactttatcacgctgcgttttgggttgaattcatc
gaacggcaccaggaagttccacacgctagaagtggagcagatcatttgaattttcttcaa
tatttcctcgttgatgtcattgccttcttcttctttgtcattttctgtactctttcaatt
atttattacacaattcggacagttttccgaacgattcgttcagtggtgaacggagttcgg
ggagttcctaaaattgtttcaaggggaaagaaaaacaattga

DBGET integrated database retrieval system