KEGG   Caenorhabditis elegans (nematode): CELE_F36H1.6Help
Entry
CELE_F36H1.6      CDS       T00019                                 

Gene name
alh-3
Definition
Protein ALH-3
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cel00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(11022584..11022710,11022842..11023073,11023120..11023306,11023358..11023963,11024008..11024734,11024817..11025408,11025459..11025714)
Genome map
AA seq 908 aa AA seqDB search
MKIAIIGQSAFGVDVYKELRKNGHEIVVVFTIPDKNGREDLLAVEAAKDGVPVQKPSRWR
KKNPETGKFETLPEMLELYKSFGAELNVLPFCTQFIPLEITEAPAKKSIIYHPSILPKHR
GASAINWTLIEGDEEAGLSIFWADDGLDTGPILLQKKCKVEENDTLNTLYKRFLYPAGVA
AVAESVELIATGKAPRIVQPEEGASYEPYITTKPELAQIDWSKTQRQLHNFIRGNDKVPG
AWAVLNGEKVSFFGSKLWKPKKLPDDAVEVFVSEVPGGKVLVEDRGLLLPGSDGRWVIVD
TVKIGTKTVPASKYGQGADQVQELVLTDEEKSTVAKLKKIWTGILKTQVSSDTDFFESGA
SSADVTRLVEEIKFNTGAELESGQIYAGPTLGENIDIVIRNLRGEGGISVTYDPIVLNVN
NMELKFPHDQFIDGKFVGSSDGRTFKTINPATEKPICELPLATVADVDRAVRAAKKAFER
GEWRQMSARERGKRLYKLAELMEEHKEELATLESLDAGAVYTLALKTHVGMSIDVWRYFA
GWCDKIQGKTIPISNARPNKNLCLTLREPIGVVGLITPWNYPLMMLSWKMAACLAAGNTV
VHKPAQVTPLTALKFAELSVLAGIPPGVINIVTGSGSLVGNRLTAHPDVRKIGFTGSTEI
GATVMESCAKSNIKKVSLELGGKSPLIIFADADLEKAVKQACGAVFFNKGENCIAAGRVF
IAKSIHDDFVKKLVEEAKQYQIGDPLDRSTAHGPQNHLAHLNKLVEYVEKAVAGGAKVEV
GGKRLEREGLYFPPTILSNIDDENFAASEESFGPIMCVSSFDDDDIEDVLRRANDTEFGL
AAGVFTRDSSKSLRVAEALHAGTVFVNTYQKTDVAAPFGGFKQSGFGKDMGEEALNEYLV
TKTITIEY
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcaatcattggtcagtcggcatttggtgtcgatgtttacaaggagttacgc
aagaatggacacgagattgttgtagtcttcactatcccagataaaaatggaagagaagat
ctattggccgtcgaggctgccaaagatggtgtcccagttcaaaaaccatctcgttggcgt
aagaagaaccctgaaactggaaaattcgaaactcttccggaaatgcttgaactttacaaa
tcgtttggagctgaactcaacgttttgccattctgcactcaattcatcccactagaaatc
actgaagcgccggctaagaagagcattatctatcatccaagtattctaccaaagcacagg
ggagcttctgccatcaattggactcttattgaaggtgatgaggaagctggattatcgatc
ttctgggctgatgatggtcttgatactggaccaattttgttgcaaaagaaatgcaaagtt
gaagagaatgatacattgaacactttatataaaagattcctgtatccagctggagtagct
gctgttgcagaatcagtagaactcattgctactggaaaagctccaagaattgtacagcca
gaagagggagcatcttatgaaccatatattaccacaaaaccagaattggctcaaatagat
tggtcgaagactcagcgtcaacttcataattttattcgtggaaatgacaaagttcctgga
gcatgggctgttttgaacggagaaaaagtttcatttttcggttcaaagttgtggaagcca
aagaagcttccagatgatgctgtagaagttttcgtttcagaagttccaggaggaaaagtt
ttagttgaagatcgtggattgctccttccaggatcagacggtagatgggttattgtagat
acagtgaagattggtacaaaaactgtcccagcttctaaatatggacagggagctgatcaa
gttcaagaacttgtattaaccgacgaagaaaagagtactgtagctaagctgaagaaaatt
tggaccggaattctgaagactcaagtttcaagtgacactgatttcttcgaaagtggtgca
agttctgctgatgttactcgtcttgtggaggagatcaagttcaatactggagctgagctt
gaatcaggacaaatctatgccgggccaactcttggtgaaaacatcgacattgtgatccgt
aatcttcgtggtgaaggtggaatctctgtaacttacgatccaattgtattgaatgttaac
aatatggaattgaaattcccacatgaccaattcattgatggaaaatttgttggttcatca
gatggacgcacttttaaaacaattaacccagcaactgaaaagccaatttgtgaacttcct
ttggctactgtagctgatgtcgatcgtgctgttcgtgcagcaaagaaagcttttgaacgt
ggagaatggcgtcaaatgtctgcccgtgaacgtggaaagagactttacaaactcgctgaa
ctcatggaagaacacaaagaagagctcgcaacactagagtccctagatgctggagcagta
tatacgttggctctaaagactcacgttggaatgtctattgatgtgtggagatactttgct
ggatggtgtgataagattcaaggaaaaactattccaatttctaatgctcgtccaaataag
aatctatgtttgacacttcgtgaaccaattggagttgttggactcattactccatggaat
tatccattaatgatgttatcgtggaagatggctgcttgccttgctgcgggtaacacagtt
gttcacaaaccagctcaagtaactccactcacagctcttaaatttgctgagctatctgtt
cttgctggaatcccacctggtgttatcaatattgtaactggatctggatcccttgttggt
aatcgtcttactgctcatccagatgttcgaaagattggattcactggttccactgaaatt
ggagcaactgtcatggaatcttgtgccaaatcgaatatcaagaaggtttccctggaactt
ggaggcaaatccccactgataattttcgcagatgctgatctagaaaaagctgtgaaacaa
gcgtgtggagcagttttcttcaataaaggagagaactgtattgctgctgggcgtgttttt
attgcaaaatcgattcatgatgatttcgtgaagaagcttgtcgaggaagctaaacaatat
caaattggagatcctctcgatagatcaactgctcacggtccacagaatcatttagcacat
cttaataagctagtcgagtatgtggagaaggctgtagctggcggagctaaagttgaagtc
ggtggaaaacgtttagaaagagaaggactctatttcccaccaacgattctgtcgaatatt
gacgatgaaaactttgctgcaagtgaagaatcattcggaccaatcatgtgtgtatccagt
tttgatgacgatgacatcgaagatgtactccgtagagccaatgacacagaattcggactt
gctgctggagtttttacccgtgactcgtcgaaatcacttcgtgttgctgaagctcttcac
gctggaacagtcttcgttaatacttatcagaaaactgatgtggcagctccattcggtgga
ttcaagcaatctggattcggaaaagatatgggagaagaagctttgaatgaatatctggtt
accaaaacaattaccattgagtattaa

DBGET integrated database retrieval system