KEGG   Caenorhabditis elegans (nematode): CELE_F36H1.6Help
Entry
CELE_F36H1.6      CDS       T00019                                 

Gene name
alh-3
Definition
Protein ALH-3
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CELE_F36H1.6 (alh-3)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     CELE_F36H1.6 (alh-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(11022605..11022731,11022863..11023094,11023141..11023327,11023379..11023984,11024029..11024755,11024838..11025429,11025480..11025735)
Genome map
AA seq 908 aa AA seqDB search
MKIAIIGQSAFGVDVYKELRKNGHEIVVVFTIPDKNGREDLLAVEAAKDGVPVQKPSRWR
KKNPETGKFETLPEMLELYKSFGAELNVLPFCTQFIPLEITEAPAKKSIIYHPSILPKHR
GASAINWTLIEGDEEAGLSIFWADDGLDTGPILLQKKCKVEENDTLNTLYKRFLYPAGVA
AVAESVELIATGKAPRIVQPEEGASYEPYITTKPELAQIDWSKTQRQLHNFIRGNDKVPG
AWAVLNGEKVSFFGSKLWKPKKLPDDAVEVFVSEVPGGKVLVEDRGLLLPGSDGRWVIVD
TVKIGTKTVPASKYGQGADQVQELVLTDEEKSTVAKLKKIWTGILKTQVSSDTDFFESGA
SSADVTRLVEEIKFNTGAELESGQIYAGPTLGENIDIVIRNLRGEGGISVTYDPIVLNVN
NMELKFPHDQFIDGKFVGSSDGRTFKTINPATEKPICELPLATVADVDRAVRAAKKAFER
GEWRQMSARERGKRLYKLAELMEEHKEELATLESLDAGAVYTLALKTHVGMSIDVWRYFA
GWCDKIQGKTIPISNARPNKNLCLTLREPIGVVGLITPWNYPLMMLSWKMAACLAAGNTV
VHKPAQVTPLTALKFAELSVLAGIPPGVINIVTGSGSLVGNRLTAHPDVRKIGFTGSTEI
GATVMESCAKSNIKKVSLELGGKSPLIIFADADLEKAVKQACGAVFFNKGENCIAAGRVF
IAKSIHDDFVKKLVEEAKQYQIGDPLDRSTAHGPQNHLAHLNKLVEYVEKAVAGGAKVEV
GGKRLEREGLYFPPTILSNIDDENFAASEESFGPIMCVSSFDDDDIEDVLRRANDTEFGL
AAGVFTRDSSKSLRVAEALHAGTVFVNTYQKTDVAAPFGGFKQSGFGKDMGEEALNEYLV
TKTITIEY
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcaatcattggtcagtcggcatttggtgtcgatgtttacaaggagttacgc
aagaatggacacgagattgttgtagtcttcactatcccagataaaaatggaagagaagat
ctattggccgtcgaggctgccaaagatggtgtcccagttcaaaaaccatctcgttggcgt
aagaagaaccctgaaactggaaaattcgaaactcttccggaaatgcttgaactttacaaa
tcgtttggagctgaactcaacgttttgccattctgcactcaattcatcccactagaaatc
actgaagcgccggctaagaagagcattatctatcatccaagtattctaccaaagcacagg
ggagcttctgccatcaattggactcttattgaaggtgatgaggaagctggattatcgatc
ttctgggctgatgatggtcttgatactggaccaattttgttgcaaaagaaatgcaaagtt
gaagagaatgatacattgaacactttatataaaagattcctgtatccagctggagtagct
gctgttgcagaatcagtagaactcattgctactggaaaagctccaagaattgtacagcca
gaagagggagcatcttatgaaccatatattaccacaaaaccagaattggctcaaatagat
tggtcgaagactcagcgtcaacttcataattttattcgtggaaatgacaaagttcctgga
gcatgggctgttttgaacggagaaaaagtttcatttttcggttcaaagttgtggaagcca
aagaagcttccagatgatgctgtagaagttttcgtttcagaagttccaggaggaaaagtt
ttagttgaagatcgtggattgctccttccaggatcagacggtagatgggttattgtagat
acagtgaagattggtacaaaaactgtcccagcttctaaatatggacagggagctgatcaa
gttcaagaacttgtattaaccgacgaagaaaagagtactgtagctaagctgaagaaaatt
tggaccggaattctgaagactcaagtttcaagtgacactgatttcttcgaaagtggtgca
agttctgctgatgttactcgtcttgtggaggagatcaagttcaatactggagctgagctt
gaatcaggacaaatctatgccgggccaactcttggtgaaaacatcgacattgtgatccgt
aatcttcgtggtgaaggtggaatctctgtaacttacgatccaattgtattgaatgttaac
aatatggaattgaaattcccacatgaccaattcattgatggaaaatttgttggttcatca
gatggacgcacttttaaaacaattaacccagcaactgaaaagccaatttgtgaacttcct
ttggctactgtagctgatgtcgatcgtgctgttcgtgcagcaaagaaagcttttgaacgt
ggagaatggcgtcaaatgtctgcccgtgaacgtggaaagagactttacaaactcgctgaa
ctcatggaagaacacaaagaagagctcgcaacactagagtccctagatgctggagcagta
tatacgttggctctaaagactcacgttggaatgtctattgatgtgtggagatactttgct
ggatggtgtgataagattcaaggaaaaactattccaatttctaatgctcgtccaaataag
aatctatgtttgacacttcgtgaaccaattggagttgttggactcattactccatggaat
tatccattaatgatgttatcgtggaagatggctgcttgccttgctgcgggtaacacagtt
gttcacaaaccagctcaagtaactccactcacagctcttaaatttgctgagctatctgtt
cttgctggaatcccacctggtgttatcaatattgtaactggatctggatcccttgttggt
aatcgtcttactgctcatccagatgttcgaaagattggattcactggttccactgaaatt
ggagcaactgtcatggaatcttgtgccaaatcgaatatcaagaaggtttccctggaactt
ggaggcaaatccccactgataattttcgcagatgctgatctagaaaaagctgtgaaacaa
gcgtgtggagcagttttcttcaataaaggagagaactgtattgctgctgggcgtgttttt
attgcaaaatcgattcatgatgatttcgtgaagaagcttgtcgaggaagctaaacaatat
caaattggagatcctctcgatagatcaactgctcacggtccacagaatcatttagcacat
cttaataagctagtcgagtatgtggagaaggctgtagctggcggagctaaagttgaagtc
ggtggaaaacgtttagaaagagaaggactctatttcccaccaacgattctgtcgaatatt
gacgatgaaaactttgctgcaagtgaagaatcattcggaccaatcatgtgtgtatccagt
tttgatgacgatgacatcgaagatgtactccgtagagccaatgacacagaattcggactt
gctgctggagtttttacccgtgactcgtcgaaatcacttcgtgttgctgaagctcttcac
gctggaacagtcttcgttaatacttatcagaaaactgatgtggcagctccattcggtgga
ttcaagcaatctggattcggaaaagatatgggagaagaagctttgaatgaatatctggtt
accaaaacaattaccattgagtattaa

DBGET integrated database retrieval system