KEGG   Caenorhabditis elegans (nematode): CELE_F38E9.2Help
Entry
CELE_F38E9.2      CDS       T00019                                 

Gene name
nas-39
Definition
Protein NAS-39
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_F38E9.2 (nas-39)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_F38E9.2 (nas-39)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(16457459..16457672,16458566..16458686,16461174..16461352,16461664..16461737,16461783..16461855,16461960..16462040,16462088..16462201,16463654..16463765,16464100..16464152,16464323..16464483,16464538..16464639,16464708..16464862,16465559..16465674,16466332..16466616,16466666..16466827,16466880..16466978,16467975..16468069,16468117..16468210,16468315..16468434,16468516..16468604,16470257..16470364,16470853..16470937,16470987..16471150)
Genome map
AA seq 951 aa AA seqDB search
MRFSANIAIIVNIIFLFIVVEFVLPTFIRSGDVRFRRYYRNNGRVSRAATAKKERIWPEG
IIPFVIASNFSGEHQHLFLRAMRHWENFTCVSFVPRQPHHKHYITFTVDKCGCCSYVGRR
GEGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDMYVDIFYKSIQTGQDYNFEKS
KPEEVDSLGEPYDFSSIMHYARDTFSRGAFYDTILPKPNSGFRLEIGQRVQLSEGDIRQT
KKLYKCAECGGTLMQESGNLAIQHAGVCTWHIISPQGHTIFLNITGGLKLIIMIIFLTDE
KLEDLTEIFKPNILKKNQTYLHWKTFLIYYTNSFFHFEILDRICGGDSLFRTIASSGNRM
LIQVRSSTPAASLPFATYYAICGGPIYANEGVIHSPKYPESYPPNSDCQWTIHVDENSQV
AIEFVYFHLEQHKECIYDRLILTEGISKNSKKDGKEMSETFCGLIEKKTIVSKTNQISLR
FFSDNSVQKTGFELRFTKELNECATDKNICHHYCVNTVGGFKCACRVGYSLSSNGFSCDS
TCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEGMKTECAYDY
VKIGDSEKLCGEYHEALLFTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCE
HTCQNRLGSYVCTCNPGYILAEDKHNCKEGSCFFEVNAPAGDINSPNYPNDYPKGQNCSW
HFVTTPGHRLMLTFSSFQVEEHAQCKYDAVSVYDGGDGSAQLAGVFCGLAPPPLLLSSSN
ELYLTFSSDASVSRRGFQAHYTSLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVR
AKSPGRGVRIQFSTFNIESEEGCQYDYIEIYDGPEATLERLVGRFCGDTSPEVITSTGPE
LLLIMHTDNAEEEKGFVAEYREAPRSSSTKRTFVSKTRHSPLEEPIHDRNE
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttctgcgaacatcgccatcatcgtaaacatcatttttctatttattgtcgtc
gagtttgtgctgcccacgtttatccgatctggtgacgtcaggttccgaagatactaccgg
aataatgggcgagtttcgagagcggcgacggcaaaaaaagaaaggatatggccagaagga
atcattccattcgttatagcatccaatttttcaggggagcaccagcacctttttctacgc
gcaatgcggcattgggagaactttacatgtgtctcgttcgtcccacgacaaccacaccac
aaacattatatcactttcactgttgataaatgcggatgttgttcttatgtgggtcggcgt
ggagaaggccctcaggcaatatcaataggcaaaaattgcgataaattcggcatcgttgta
cacgaactgggacatgttgttggtttctggcacgagcatactcgacctgatagggatatg
tatgtggatatcttctacaaaagtatacagacaggtcaggactataatttcgagaagtcc
aaaccggaagaagttgattcacttggggagccatatgatttctcatcgattatgcattac
gctagagacacattttcaaggggagctttctatgatacaattttgccgaaaccaaattca
ggattccgtttggaaattgggcaacgtgtccagttgagtgaaggagatatccgacaaacg
aaaaagctctataaatgcgcagaatgcggcggcactttgatgcaagagtccggaaatttg
gcgattcaacacgcgggcgtatgcacatggcatattatttccccgcaaggccatacaatt
tttctaaacatcacaggtggcctaaaattaattattatgattatatttcttacggatgaa
aagcttgaagatttaacggaaattttcaagccaaatatcttgaaaaaaaatcaaacttat
ttacactggaaaacatttttgatatactacacaaattcgttttttcattttgaaattttg
gatagaatatgcggtggagactcgttgttccgaaccattgcatcatctggcaatcgaatg
ctcatccaagtgaggtcgtctactccagcagcttccctaccatttgccacttactatgca
atttgtggcggaccaatttatgccaatgaaggggttattcatagcccgaagtatccggag
tcctacccaccaaacagcgactgtcagtggacaattcatgtggatgagaatagccaagta
gccattgaatttgtatattttcacttggagcaacacaaagaatgtatatatgaccggttg
atcttaaccgaaggaatatcgaaaaattcgaaaaaagacggcaaggaaatgagtgaaaca
ttttgcggtcttattgaaaagaaaaccattgtgagcaagactaatcaaatttcattgaga
ttcttctctgacaactctgttcaaaaaacaggctttgaattacgcttcacgaaagagctg
aacgagtgcgccacggacaagaacatctgccatcattattgtgtgaacactgttggagga
ttcaagtgtgcttgccgagttgggtacagcctatccagcaatggattttcttgcgatagt
acctgtggaggatacctaaaagcgtcaaacggctccatttcatctccgaactttccggaa
atgtatccgaactctaaaacttgtatttgggaaattgaagctccggatggttatcatatt
ttcttgaacttcaccaaattcaacgtggaaggcatgaaaactgaatgtgcatacgactac
gtaaagattggagacagtgagaagctatgcggagagtaccatgaagcattgctctttacc
acacctcgcaacagggttcgcatcgagttcagctcagattcatccgttgagcgtgatgga
ttttttgcgaatttcatagcggactttgatgaatgtcagaacgataacgctggatgtgaa
catacttgccagaatcgacttgggtcatacgtatgcacatgcaatccggggtacatcttg
gccgaagacaaacacaattgtaaagaagggagctgtttctttgaggttaatgcaccagca
ggtgatatcaattctccaaactacccgaatgactatccaaaaggtcagaactgctcttgg
cattttgtcaccactccaggtcatcgtctgatgctgacattttctagttttcaagttgaa
gaacatgctcaatgcaaatacgatgctgtgtccgtatatgacggcggagatggatcagca
cagctagccggcgtgttctgcggcctggctccacccccactccttctatcgtcctccaac
gagctctatctcactttttcgtcggacgcgtcggtctctagacgaggctttcaggctcat
tacacttctttatgcggaggtcgtctaacagctgaatcaacgcctgggcacatctactcg
catgcgacgttcagtgatagcaaatacgggaaaaatcaagactgctcatggattgtcaga
gcaaaatcgccgggacgtggcgtgcggattcagttctcaactttcaacattgaatctgag
gagggatgtcagtatgactatattgagatttacgatggacctgaagctacattggagcgc
cttgttggcaggttttgtggtgatactagtccggaagttataactagcacaggtcctgag
ctcctgcttatcatgcatacggacaatgctgaggaagaaaaaggttttgttgcggagtat
cgagaagctccgagatcaagctcgacgaaacgaacttttgtctcaaagacacgtcacagc
ccattagaagagccaatacatgatcggaatgaatga

DBGET integrated database retrieval system