KEGG   Caenorhabditis elegans (nematode): CELE_F38E9.2Help
Entry
CELE_F38E9.2      CDS       T00019                                 

Gene name
nas-39
Definition
Protein NAS-39
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_F38E9.2 (nas-39)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_F38E9.2 (nas-39)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(16457387..16457600,16458494..16458614,16461102..16461280,16461591..16461664,16461710..16461782,16461887..16461967,16462015..16462128,16463581..16463692,16464027..16464079,16464250..16464410,16464465..16464566,16464635..16464789,16465486..16465601,16466259..16466543,16466593..16466754,16466807..16466905,16467902..16467996,16468044..16468137,16468242..16468361,16468443..16468531,16470184..16470291,16470780..16470864,16470914..16471077)
Genome map
AA seq 951 aa AA seqDB search
MRFSANIAIIVNIIFLFIVVEFVLPTFIRSGDVRFRRYYRNNGRVSRAATAKKERIWPEG
IIPFVIASNFSGEHQHLFLRAMRHWENFTCVSFVPRQPHHKHYITFTVDKCGCCSYVGRR
GEGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDMYVDIFYKSIQTGQDYNFEKS
KPEEVDSLGEPYDFSSIMHYARDTFSRGAFYDTILPKPNSGFRLEIGQRVQLSEGDIRQT
KKLYKCAECGGTLMQESGNLAIQHAGVCTWHIISPQGHTIFLNITGGLKLIIMIIFLTDE
KLEDLTEIFKPNILKKNQTYLHWKTFLIYYTNSFFHFEILDRICGGDSLFRTIASSGNRM
LIQVRSSTPAASLPFATYYAICGGPIYANEGVIHSPKYPESYPPNSDCQWTIHVDENSQV
AIEFVYFHLEQHKECIYDRLILTEGISKNSKKDGKEMSETFCGLIEKKTIVSKTNQISLR
FFSDNSVQKTGFELRFTKELNECATDKNICHHYCVNTVGGFKCACRVGYSLSSNGFSCDS
TCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEGMKTECAYDY
VKIGDSEKLCGEYHEALLFTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCE
HTCQNRLGSYVCTCNPGYILAEDKHNCKEGSCFFEVNAPAGDINSPNYPNDYPKGQNCSW
HFVTTPGHRLMLTFSSFQVEEHAQCKYDAVSVYDGGDGSAQLAGVFCGLAPPPLLLSSSN
ELYLTFSSDASVSRRGFQAHYTSLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVR
AKSPGRGVRIQFSTFNIESEEGCQYDYIEIYDGPEATLERLVGRFCGDTSPEVITSTGPE
LLLIMHTDNAEEEKGFVAEYREAPRSSSTKRTFVSKTRHSPLEEPIHDRNE
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttctgcgaacatcgccatcatcgtaaacatcatttttctatttattgtcgtc
gagtttgtgctgcccacgtttatccgatctggtgacgtcaggttccgaagatactaccgg
aataatgggcgagtttcgagagcggcgacggcaaaaaaagaaaggatatggccagaagga
atcattccattcgttatagcatccaatttttcaggggagcaccagcacctttttctacgc
gcaatgcggcattgggagaactttacatgtgtctcgttcgtcccacgacaaccacaccac
aaacattatatcactttcactgttgataaatgcggatgttgttcttatgtgggtcggcgt
ggagaaggccctcaggcaatatcaataggcaaaaattgcgataaattcggcatcgttgta
cacgaactgggacatgttgttggtttctggcacgagcatactcgacctgatagggatatg
tatgtggatatcttctacaaaagtatacagacaggtcaggactataatttcgagaagtcc
aaaccggaagaagttgattcacttggggagccatatgatttctcatcgattatgcattac
gctagagacacattttcaaggggagctttctatgatacaattttgccgaaaccaaattca
ggattccgtttggaaattgggcaacgtgtccagttgagtgaaggagatatccgacaaacg
aaaaagctctataaatgcgcagaatgcggcggcactttgatgcaagagtccggaaatttg
gcgattcaacacgcgggcgtatgcacatggcatattatttccccgcaaggccatacaatt
tttctaaacatcacaggtggcctaaaattaattattatgattatatttcttacggatgaa
aagcttgaagatttaacggaaattttcaagccaaatatcttgaaaaaaaatcaaacttat
ttacactggaaaacatttttgatatactacacaaattcgttttttcattttgaaattttg
gatagaatatgcggtggagactcgttgttccgaaccattgcatcatctggcaatcgaatg
ctcatccaagtgaggtcgtctactccagcagcttccctaccatttgccacttactatgca
atttgtggcggaccaatttatgccaatgaaggggttattcatagcccgaagtatccggag
tcctacccaccaaacagcgactgtcagtggacaattcatgtggatgagaatagccaagta
gccattgaatttgtatattttcacttggagcaacacaaagaatgtatatatgaccggttg
atcttaaccgaaggaatatcgaaaaattcgaaaaaagacggcaaggaaatgagtgaaaca
ttttgcggtcttattgaaaagaaaaccattgtgagcaagactaatcaaatttcattgaga
ttcttctctgacaactctgttcaaaaaacaggctttgaattacgcttcacgaaagagctg
aacgagtgcgccacggacaagaacatctgccatcattattgtgtgaacactgttggagga
ttcaagtgtgcttgccgagttgggtacagcctatccagcaatggattttcttgcgatagt
acctgtggaggatacctaaaagcgtcaaacggctccatttcatctccgaactttccggaa
atgtatccgaactctaaaacttgtatttgggaaattgaagctccggatggttatcatatt
ttcttgaacttcaccaaattcaacgtggaaggcatgaaaactgaatgtgcatacgactac
gtaaagattggagacagtgagaagctatgcggagagtaccatgaagcattgctctttacc
acacctcgcaacagggttcgcatcgagttcagctcagattcatccgttgagcgtgatgga
ttttttgcgaatttcatagcggactttgatgaatgtcagaacgataacgctggatgtgaa
catacttgccagaatcgacttgggtcatacgtatgcacatgcaatccggggtacatcttg
gccgaagacaaacacaattgtaaagaagggagctgtttctttgaggttaatgcaccagca
ggtgatatcaattctccaaactacccgaatgactatccaaaaggtcagaactgctcttgg
cattttgtcaccactccaggtcatcgtctgatgctgacattttctagttttcaagttgaa
gaacatgctcaatgcaaatacgatgctgtgtccgtatatgacggcggagatggatcagca
cagctagccggcgtgttctgcggcctggctccacccccactccttctatcgtcctccaac
gagctctatctcactttttcgtcggacgcgtcggtctctagacgaggctttcaggctcat
tacacttctttatgcggaggtcgtctaacagctgaatcaacgcctgggcacatctactcg
catgcgacgttcagtgatagcaaatacgggaaaaatcaagactgctcatggattgtcaga
gcaaaatcgccgggacgtggcgtgcggattcagttctcaactttcaacattgaatctgag
gagggatgtcagtatgactatattgagatttacgatggacctgaagctacattggagcgc
cttgttggcaggttttgtggtgatactagtccggaagttataactagcacaggtcctgag
ctcctgcttatcatgcatacggacaatgctgaggaagaaaaaggttttgttgcggagtat
cgagaagctccgagatcaagctcgacgaaacgaacttttgtctcaaagacacgtcacagc
ccattagaagagccaatacatgatcggaatgaatga

DBGET integrated database retrieval system