KEGG   Caenorhabditis elegans (nematode): CELE_F39G3.1Help
Entry
CELE_F39G3.1      CDS       T00019                                 

Gene name
ugt-61
Definition
(RefSeq) UDP-glucuronosyltransferase
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CELE_F39G3.1 (ugt-61)
   00053 Ascorbate and aldarate metabolism
    CELE_F39G3.1 (ugt-61)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CELE_F39G3.1 (ugt-61)
   00860 Porphyrin and chlorophyll metabolism
    CELE_F39G3.1 (ugt-61)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CELE_F39G3.1 (ugt-61)
   00982 Drug metabolism - cytochrome P450
    CELE_F39G3.1 (ugt-61)
   00983 Drug metabolism - other enzymes
    CELE_F39G3.1 (ugt-61)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CELE_F39G3.1 (ugt-61)
Glycosyltransferases [BR:cel01003]
 Others
  Hydrophobic molecule
   CELE_F39G3.1 (ugt-61)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
V:join(4742520..4742609,4742718..4742838,4743140..4743587,4743634..4743727,4744164..4744274,4744324..4744602,4744789..4744955,4745020..4745302)
Genome map
AA seq 530 aa AA seqDB search
MRVLSVFLVLVGVVSAYKFVLFVPNVANSQIQFNARVAEVLAIGGHDVTMLMVNHMAGFE
SNVKVPKGVKTYQLDAAVEGITKQSIEKEQSAMLYKNMGLKDMPQMMAMFSRMGKLLQDG
CRIILRNKEFLKWLEDEKFDVAYTHIYSTCPLGLIHHAKIPSWVWLNSGPLMDYVSQAVG
VPILPSYVPPVLMASHDEMGFVQRTKSFIGHVLMSVMHRRISSDEETAIFRKELNDPSFP
HTMDIGAKCPLVIVNSNELYDLPRPTLAKVINIGGLGVGFDSAKPLTGEFKKISETGNGL
IVFSFGSVAAAHEMPLAWKNSLLEAFASLPDYQFVMRYEGDDLKDRLPENVHLSKWLPQK
DLLLHEKTKAFITHGGYNSLQEAISAGVPLITIALMGDQPKNSQIAKKHGFAVNIEKGTI
SKETVVEALREILENDSYKQKVTRLSAMVRAQPMKPAERLLKWSEFLAEFKTLDNLVPAG
QKLNFYQYHSLDVIGFLFLVVLVVFYIGFLILKAVFRKCCRRRETKTKND
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagagtattgtcggtttttctggtattagtgggagtagtttcagcatacaaatttgtt
ttatttgtcccaaatgtagctaacagtcagattcaattcaacgctagagtagccgaggtt
cttgcaattggaggtcatgacgtaactatgctaatggtgaaccatatggctggatttgag
tcaaacgtaaaagtaccgaaaggtgttaaaacctatcaactcgacgctgctgttgaagga
atcacaaagcaatccatcgaaaaagaacaatcagccatgttatacaagaacatggggctt
aaggatatgcctcaaatgatggcaatgttcagtcgaatgggaaagctacttcaagatgga
tgccgaatcattcttcgcaacaaggaattcttgaaatggctggaagatgagaaatttgat
gtcgcatacactcatatttactctacgtgcccacttggattaattcatcacgccaaaatt
ccgtcttgggtctggcttaacagtggtccactaatggattatgtatcacaggcagttgga
gttccgattcttcccagctatgtaccgcccgtattgatggcatctcatgatgaaatgggt
tttgttcaaagaacaaaaagttttatcggtcatgtgctaatgagtgttatgcacagaaga
atctcatccgacgaggagacagcaatcttccgaaaggaattgaatgatccgagttttcct
cataccatggatattggagccaaatgcccactggtaattgtaaacagcaatgaactctac
gatctaccacgtcccactttggccaaagtgataaatattggagggcttggtgtcggattt
gacagtgctaaaccattgactggagagttcaagaaaatctctgaaactggaaatgggctt
attgtcttctcatttggctcagtggcagctgcccatgaaatgcccttggcttggaaaaac
tcgcttttggaagcttttgcatctctaccagactaccagtttgtcatgagatatgaagga
gatgatctgaaggatagattgccggaaaatgtgcatttgtcgaagtggcttccacagaag
gatctactgttgcacgagaagacaaaagcgtttattactcatggagggtacaattctttg
caggaagcaatatccgccggagtcccccttatcactattgctctcatgggcgatcagccc
aaaaactcccaaatcgccaagaaacatggatttgctgtgaacattgaaaaaggaacaatt
tccaaggaaacggtcgttgaagctcttagagaaattttggagaatgatagctacaaacaa
aaagtaacccggctctccgcgatggttcgagctcaaccaatgaagccggctgaacgtctt
ctgaaatggtcagagtttcttgcggaattcaagacacttgacaacctggtgccagctgga
cagaagcttaacttttatcaatatcattctcttgatgtaatcggcttcttgttcctagta
gttttagttgtattctacattggcttccttattctgaaagcagttttcagaaaatgttgc
cgtagaagagagactaaaactaagaacgattga

DBGET integrated database retrieval system