KEGG   Caenorhabditis elegans (nematode): CELE_F39G3.1Help
Entry
CELE_F39G3.1      CDS       T00019                                 

Gene name
ugt-61
Definition
Protein UGT-61
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CELE_F39G3.1 (ugt-61)
   00053 Ascorbate and aldarate metabolism
    CELE_F39G3.1 (ugt-61)
   00500 Starch and sucrose metabolism
    CELE_F39G3.1 (ugt-61)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CELE_F39G3.1 (ugt-61)
   00860 Porphyrin and chlorophyll metabolism
    CELE_F39G3.1 (ugt-61)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CELE_F39G3.1 (ugt-61)
   00982 Drug metabolism - cytochrome P450
    CELE_F39G3.1 (ugt-61)
   00983 Drug metabolism - other enzymes
    CELE_F39G3.1 (ugt-61)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CELE_F39G3.1 (ugt-61)
Glycosyltransferases [BR:cel01003]
 Others
  Hydrophobic molecule
   CELE_F39G3.1 (ugt-61)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(4742506..4742595,4742704..4742824,4743126..4743573,4743620..4743713,4744150..4744260,4744310..4744588,4744775..4744941,4745006..4745288)
Genome map
AA seq 530 aa AA seqDB search
MRVLSVFLVLVGVVSAYKFVLFVPNVANSQIQFNARVAEVLAIGGHDVTMLMVNHMAGFE
SNVKVPKGVKTYQLDAAVEGITKQSIEKEQSAMLYKNMGLKDMPQMMAMFSRMGKLLQDG
CRIILRNKEFLKWLEDEKFDVAYTHIYSTCPLGLIHHAKIPSWVWLNSGPLMDYVSQAVG
VPILPSYVPPVLMASHDEMGFVQRTKSFIGHVLMSVMHRRISSDEETAIFRKELNDPSFP
HTMDIGAKCPLVIVNSNELYDLPRPTLAKVINIGGLGVGFDSAKPLTGEFKKISETGNGL
IVFSFGSVAAAHEMPLAWKNSLLEAFASLPDYQFVMRYEGDDLKDRLPENVHLSKWLPQK
DLLLHEKTKAFITHGGYNSLQEAISAGVPLITIALMGDQPKNSQIAKKHGFAVNIEKGTI
SKETVVEALREILENDSYKQKVTRLSAMVRAQPMKPAERLLKWSEFLAEFKTLDNLVPAG
QKLNFYQYHSLDVIGFLFLVVLVVFYIGFLILKAVFRKCCRRRETKTKND
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagagtattgtcggtttttctggtattagtgggagtagtttcagcatacaaatttgtt
ttatttgtcccaaatgtagctaacagtcagattcaattcaacgctagagtagccgaggtt
cttgcaattggaggtcatgacgtaactatgctaatggtgaaccatatggctggatttgag
tcaaacgtaaaagtaccgaaaggtgttaaaacctatcaactcgacgctgctgttgaagga
atcacaaagcaatccatcgaaaaagaacaatcagccatgttatacaagaacatggggctt
aaggatatgcctcaaatgatggcaatgttcagtcgaatgggaaagctacttcaagatgga
tgccgaatcattcttcgcaacaaggaattcttgaaatggctggaagatgagaaatttgat
gtcgcatacactcatatttactctacgtgcccacttggattaattcatcacgccaaaatt
ccgtcttgggtctggcttaacagtggtccactaatggattatgtatcacaggcagttgga
gttccgattcttcccagctatgtaccgcccgtattgatggcatctcatgatgaaatgggt
tttgttcaaagaacaaaaagttttatcggtcatgtgctaatgagtgttatgcacagaaga
atctcatccgacgaggagacagcaatcttccgaaaggaattgaatgatccgagttttcct
cataccatggatattggagccaaatgcccactggtaattgtaaacagcaatgaactctac
gatctaccacgtcccactttggccaaagtgataaatattggagggcttggtgtcggattt
gacagtgctaaaccattgactggagagttcaagaaaatctctgaaactggaaatgggctt
attgtcttctcatttggctcagtggcagctgcccatgaaatgcccttggcttggaaaaac
tcgcttttggaagcttttgcatctctaccagactaccagtttgtcatgagatatgaagga
gatgatctgaaggatagattgccggaaaatgtgcatttgtcgaagtggcttccacagaag
gatctactgttgcacgagaagacaaaagcgtttattactcatggagggtacaattctttg
caggaagcaatatccgccggagtcccccttatcactattgctctcatgggcgatcagccc
aaaaactcccaaatcgccaagaaacatggatttgctgtgaacattgaaaaaggaacaatt
tccaaggaaacggtcgttgaagctcttagagaaattttggagaatgatagctacaaacaa
aaagtaacccggctctccgcgatggttcgagctcaaccaatgaagccggctgaacgtctt
ctgaaatggtcagagtttcttgcggaattcaagacacttgacaacctggtgccagctgga
cagaagcttaacttttatcaatatcattctcttgatgtaatcggcttcttgttcctagta
gttttagttgtattctacattggcttccttattctgaaagcagttttcagaaaatgttgc
cgtagaagagagactaaaactaagaacgattga

DBGET integrated database retrieval system