KEGG   Caenorhabditis elegans (nematode): CELE_F40E10.1Help
Entry
CELE_F40E10.1     CDS       T00019                                 

Gene name
hch-1
Definition
Protein HCH-1
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_F40E10.1 (hch-1)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_F40E10.1 (hch-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(14696519..14696687,14696733..14697202,14698000..14698211,14698259..14698561,14698607..14698701,14699306..14699432,14699477..14699861,14699909..14699965))
Genome map
AA seq 605 aa AA seqDB search
MVSYWPVLIVLCLLPICHAKSYFADFVNGKGPFKQADALKFMDKMTILNKLQADILGIPQ
PDEFSALDFEDKIESKPDEIPYLFEGDMVLTDEQMDLIIKNVRDQYWARKSSTNEFLYAI
RGKRSMTSFLSERWSFPVPYYIDTSSGVNTNAVLAGVAKWEQETCARFTRLNSYSSSSRQ
NALRFISGNGCYSNIGKVSRFPQDVSIGWGCTSLGTVCHEIGHALGFYHEQARYDRDDYV
SILTQNIQDMYLSQFTKQSASSMVDYGVGYDYGSVMHYDQAAFSSTGGNTIATRDPNFQA
TIGQRVAPSFADVKRINFAYCNSTCSNYLDCQNGGYINPNDCNNCKCPPGFGGQLCDVAG
TNSNGCGAGDITATSSIQTISASGALTCNYVIKAPVGAKVYFQMTAATFSRYSPCTTNYL
EINYGRDFSRVGARFCASYPTISLSETNTLVVIYKGVNGARFSLNYRYDPVTFSTSAPTT
TSTTTTTAPITVPTVSPTTTTTRQTTTTARTSTTTTTTQAPPTTTTSTSQCASWSACSAQ
CGGCGTQSRRCGTYVETVYCNTNPCTGGYCCRPFFYVTSFGTGYCRRPGADTPAAPQRYV
EQRKG
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctactggccggtgctgatcgttctgtgccttcttccaatttgtcatgctaaa
agctattttgccgacttcgttaatggaaagggacctttcaaacaagcagatgccctaaaa
ttcatggacaaaatgaccattttgaacaaacttcaagctgatattcttggcattccacaa
cccgatgaattttcagcgttggattttgaagacaaaattgaaagcaaacccgatgaaatt
ccgtatcttttcgaaggagacatggtacttaccgatgaacaaatggatttgattattaaa
aacgtccgtgatcaatactgggctcgcaaatcttcaactaatgaattcctctacgcaatt
cgtggaaagagatcaatgacttcattcttgtcagaacgttggtcattcccagtgccatac
tatattgatacatcatcaggagtaaacacgaatgcggttctggccggagtagcaaaatgg
gagcaggaaacgtgcgcaagattcacaagattgaatagttatagttcctcgtcgaggcaa
aatgccttaagattcatatctggcaacgggtgttattcgaatattggcaaggtgagccga
tttcctcaagacgtgtcaattggatggggatgcacctcgcttggaacagtgtgccatgaa
ataggtcacgcccttggattctaccacgaacaagctcgttacgatcgtgatgactatgtt
tcaattctcacccaaaacattcaagacatgtatctttctcaatttacgaaacagtccgca
tctagtatggtagactacggagttggctacgattacggatctgttatgcattatgaccag
gcggcgttctcctctaccggcggaaacacaattgctacacgtgatccaaactttcaagca
actattgggcagagagtcgctccatcttttgcagatgtcaagagaattaactttgcttat
tgtaattctacttgttctaattacctcgactgtcaaaatggtgggtacatcaatccaaat
gactgtaacaactgcaaatgtccacctggtttcggtggacaactttgtgatgttgccgga
accaatagtaatgggtgtggtgcaggagatatcactgcgacaagttccattcaaactatt
tctgcatcaggtgccttgacttgtaattatgttatcaaggccccagttggcgcaaaagtc
tacttccaaatgacagctgccacattctcccgatactctccatgcaccaccaactacctg
gaaatcaactacggaagagatttcagcagagttggagcacgattctgtgcatcttatcca
actatctccttatctgaaaccaatactcttgttgtgatttataaaggagtaaacggagcg
aggttctcattgaactatcgttatgatcctgtaactttttcaacatctgccccaacaacc
acttccaccaccacgaccacggctccaataacggttccaaccgtttccccaactacaact
actaccaggcaaaccacaactaccgctcgcacatctacaacaaccaccactacccaagct
ccacctacgaccaccacgtcaacatcgcaatgtgcatcctggtcggcttgttccgcacaa
tgtggaggatgtggaactcaatcgagaagatgcggtacctacgtggaaactgtctactgt
aacaccaacccatgtactggaggatattgctgccgtccgttcttctacgtaacatcgttc
ggcactggatactgtagacggccaggagcagatacaccagcggctccacaacgatatgtt
gagcagagaaaaggctaa

DBGET integrated database retrieval system