KEGG   Caenorhabditis elegans (nematode): CELE_F40F12.5Help
Entry
CELE_F40F12.5     CDS       T00019                                 

Gene name
cyld-1
Definition
Protein CYLD-1, isoform A
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(9898910..9899059,9899222..9899882,9899955..9900203,9900251..9900731,9900805..9901213,9901502..9901637,9901688..9901836,9902479..9902638,9902683..9902785,9903731..9903815,9906860..9906964,9909000..9909108,9909152..9909228,9909509..9909634,9910028..9910267,9910322..9910479,9910532..9910568))
Genome map
AA seq 1144 aa AA seqDB search
MPGEFAKFPEQSAGSHQFRNPLDELTGSNTITNLTAHDFDYFTQSEKNSNLYTSENTSNS
NRLNLNQNIPVGTLIDGFELINEASGSGFLDDQLVDVSDYSRDRTTKLDRNRNSPELIVA
LLQRKVQGIRFSSNYGREEEPCVIEIPPGTMVREMADDDWKMSELKEWFTKSRASSHLRD
GLAMPMEELDCTPLICAMITRSDVMRINQDQAIHLLAVSVEKRIEVYQNFEWFNFILNLK
IGDSVSVEVDETMRRVPAKVSWIGERPEASGIWYNVDFDGNTSQWPSSNQSYSSSHDRLN
RQFDTNWNFEMSGSSSVAPSNSRLYYSPNQMHMPMKGGGVSALYDNRRLVQYSGDEEQYR
SAPKPAPRERIIPVSRQQPEIEQRNSRSMKPSEPDYNTYSTHPPRPPPSSSMNYPSMSNT
HSLQPSRSKSVQTIQRNQFVRQNPAERNERVESDQLNFRIGDQCIWNNNGAEERGIIKYI
GFLKGHKTLYAGVEFKNTIGAGTGVFNREQLFLAKDGHAGFVELSSLESPSSSISSTSTS
SSQHRRRLSSSRSQQMPAASGTSISVPVNGRHNVNGKQASIESLSDPPPPPYAPPSPPRA
SSAAAAHQQPPPLPPKPLARVEDFLIDSYDIGSHVVVRHLGAQRTGVVRWLGEEIDDEGD
RIVRSAIVQLDEDVPTAWRRSHDASSYTGSPVVGGVLVPIQSLKHNHSGSSSNGASVVQT
STYPTSQTYNNISRRTEDFGSMDSGVEKQKCGIAKDMQQLVGRQKGIQGYCNSCYLDATL
YAMFVQTTCFDFLLEKSIKGSETAQQFQKILAHEIVFPLRKVHYVRADHVMKLRKLLAEL
MPHVTGLTNEEKDPEEILGFIFSKVFHAEPFIKLIGQNHAKDSQYLVPIVVDDWLGGAAT
SQHLLERHMRSAQVTFAKAPPVLIMQLPRYGQQKVFDKILPLETIDITPFVAGAVPACSK
CQACSEVYCPTCFLTRRVFYSEVIFCRKCFHHTHLLPEIEDHKSRDLYPPGKPQKKPHSH
KMVLSAVLCIETSHYVAYVRTSSNQWVFFDSMADREGLSDGFNVPVVRECGNMSDWLSLQ
GWNRLKDADECGQIKAMFGKQSSLDPLVGRLLSDSYICFYEDASPTSSSSSSSTIISSIK
NMMN
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcgaatttgcaaagtttccggagcaatcagctggatctcatcaatttcgtaac
ccactcgatgaacttacgggatcaaatacaataacaaatttaactgcacacgattttgat
tattttacacagtccgagaaaaattcaaatttatatacaagtgaaaatacaagcaattct
aacagattaaatctcaatcaaaatataccggtcggcacattaatagatggatttgagctt
attaatgaagcttctggctccggctttttagatgatcaattagtggatgttagcgattat
agccgagataggacgacgaagctggataggaataggaattctcccgagctaatagttgct
cttttgcaacgaaaagttcaaggaattcgattttcatcgaattatggaagagaggaagaa
ccatgtgttattgagatcccaccaggaacaatggttcgcgaaatggcagatgatgattgg
aaaatgtctgaattaaaagaatggttcacaaaatcaagagcttcttcgcatttacgtgat
ggattagcaatgcccatggaggaactcgactgcactcctctgatttgtgcaatgattacc
agatccgatgtaatgagaataaaccaagatcaagcaatacatcttctggctgtcagtgta
gagaaacgaatagaagtttatcaaaatttcgaatggttcaatttcattctgaatctgaaa
attggcgattctgtttctgtggaagtggacgaaacaatgcgacgggttccagcaaaagtg
tcgtggatcggtgagagaccggaagcatcaggaatatggtataatgtggactttgacggg
aacacttctcagtggccttcttcaaatcaatcatattcatcatcccatgaccgactgaat
cgtcaatttgatacgaattggaattttgaaatgtctggatcttcttcagttgcaccttcc
aattcccgtctatattattcacccaatcaaatgcatatgccaatgaaaggcggtggagtg
tcagctctatacgataatagaaggcttgtgcaatattctggagatgaagaacaatatcga
agtgcaccaaaaccggctccaagagaacgaattattccagtttcaaggcaacaaccagaa
attgaacaacggaatagtcgatctatgaaaccttctgaaccggattataatacttattcg
actcatccaccacggccgccaccatcatcatcaatgaattatccatctatgtcaaataca
cattcattacaaccaagtcgaagtaaaagtgttcaaacaattcaaagaaatcaattcgtt
cgacaaaatcctgcagaaagaaatgaacgagttgaaagtgatcaactgaactttcgaatt
ggtgatcaatgtatttggaataataatggagctgaggaaagaggaattattaaatatatt
ggtttcttgaaagggcacaaaacattatatgctggtgtcgaatttaaaaacacaattgga
gcaggcactggtgtcttcaatcgagaacagctattccttgctaaagatggtcatgctggt
ttcgttgaactttcttcactggaatcaccatcctcttctatatcatccacgtctacatca
tcatctcagcatcgtcgtcgattatcttcctcgaggagtcaacagatgccagctgcatcg
ggaacttccattagtgtcccggttaatggacgtcacaatgtgaatggaaagcaagcgtcg
atagaatcactttcggatcctccaccaccaccgtacgcaccgccatctccgccaagagca
tcgtctgccgctgcggctcaccagcaaccaccgcctttgcctccgaagccattagctaga
gtggaagattttctgattgattcgtatgatattggaagtcatgttgttgtcagacatctt
ggagcacaacgtacaggagttgttcgatggctcggcgaggaaattgacgacgaaggagat
cgaattgttcgttcagcgattgttcaactggatgaggatgttccgacggcttggcgtcga
agtcatgatgcttcctcgtacactggttctccagtagttggaggtgttcttgttccgatt
caatctctgaagcacaatcattcgggatcgtcttccaatggagcttctgtagttcagact
tcaacctatccaactagccaaacgtataataacatcagccggcgaactgaagatttcgga
agtatggattcaggagtggagaagcaaaaatgtggaattgcaaaggacatgcaacaatta
gttggcaggcagaaaggaattcagggttactgtaactcgtgttatctggatgccacgttg
tatgcaatgtttgtccaaaccacttgctttgattttcttcttgaaaaatcgatcaaagga
tcagaaacggctcaacaatttcaaaaaattctggcccacgagatcgtgttccctcttcga
aaagttcattatgtgcgagcggatcatgtcatgaaacttcgaaaattgctcgctgagctc
atgccgcatgtaacagggcttacaaatgaagaaaaagatccagaagagattcttggattc
atattctccaaagttttccatgctgagccattcataaagttgatcggacaaaatcacgca
aaagattctcaatatcttgtaccaattgtggtggatgattggctgggaggtgcagcaact
tcacagcatttgctcgaacggcatatgagatcagctcaagtaacatttgcaaaagctcct
ccagtattgattatgcaattaccaagatatggacaacagaaagtgtttgataagattctt
cctctggaaacaattgacattactccgttcgttgctggagcggttccggcttgttcaaaa
tgtcaagcatgctcagaagtctactgcccgacgtgtttcctgacgagaagagttttctat
tcggaagtgatattctgcagaaaatgtttccaccatacacatcttttgccggaaattgaa
gatcacaagagtcgagatctctacccacctggaaaaccacaaaagaaaccacactcccac
aaaatggttctctcagcggttctgtgcatagaaacatctcattacgttgcttatgttcga
acttcatcgaatcaatgggtattctttgattcgatggctgatcgagaaggactatctgat
gggttcaatgttccagtggtcagagaatgtggaaatatgtccgattggttatcactgcaa
ggatggaatcgtttgaaggatgctgatgagtgtggacagattaaggcaatgttcggcaaa
caatcatcgttggatcctctggtaggacgtctcctttccgacagttatatttgtttctac
gaggacgcctcaccgacatcttcgtcatcttcctcctctaccatcataagctcgattaaa
aatatgatgaactag

DBGET integrated database retrieval system