KEGG   Caenorhabditis elegans (nematode): CELE_F40F12.5Help
Entry
CELE_F40F12.5     CDS       T00019                                 

Gene name
cyld-1
Definition
(RefSeq) CYLD-1, isoform A
  KO
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_F40F12.5 (cyld-1)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C67
   CELE_F40F12.5 (cyld-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
III:complement(join(9898998..9899147,9899310..9899970,9900043..9900291,9900339..9900819,9900893..9901301,9901590..9901725,9901776..9901924,9902567..9902726,9902771..9902873,9903819..9903903,9906948..9907052,9909088..9909196,9909240..9909316,9909597..9909722,9910116..9910355,9910411..9910568,9910621..9910657))
Genome map
AA seq 1144 aa AA seqDB search
MPGEFAKFPEQSAGSHQFRNPLDELTGSNTITNLTAHDFDYFTQSEKNSNLYTSENTSNS
NRLNLNQNIPVGTLIDGFELINEASGSGFLDDQLVDVSDYSRDRTTKLDRNRNSPELIVA
LLQRKVQGIRFSSNYGREEEPCVIEIPPGTMVREMADDDWKMSELKEWFTKSRASSHLRD
GLAMPMEELDCTPLICAMITRSDVMRINQDQAIHLLAVSVEKRIEVYQNFEWFNFILNLK
IGDSVSVEVDETMRRVPAKVSWIGERPEASGIWYNVDFDGNTSQWPSSNQSYSSSHDRLN
RQFDTNWNFEMSGSSSVAPSNSRLYYSPNQMHMPMKGGGVSALYDNRRLVQYSGDEEQYR
SAPKPAPRERIIPVSRQQPEIEQRNSRSMKPSEPDYNTYSTHPPRPPPSSSMNYPSMSNT
HSLQPSRSKSVQTIQRNQFVRQNPAERNERVESDQLNFRIGDQCIWNNNGAEERGIIKYI
GFLKGHKTLYAGVEFKNTIGAGTGVFNREQLFLAKDGHAGFVELSSLESPSSSISSTSTS
SSQHRRRLSSSRSQQMPAASGTSISVPVNGRHNVNGKQASIESLSDPPPPPYAPPSPPRA
SSAAAAHQQPPPLPPKPLARVEDFLIDSYDIGSHVVVRHLGAQRTGVVRWLGEEIDDEGD
RIVRSAIVQLDEDVPTAWRRSHDASSYTGSPVVGGVLVPIQSLKHNHSGSSSNGASVVQT
STYPTSQTYNNISRRTEDFGSMDSGVEKQKCGIAKDMQQLVGRQKGIQGYCNSCYLDATL
YAMFVQTTCFDFLLEKSIKGSETAQQFQKILAHEIVFPLRKVHYVRADHVMKLRKLLAEL
MPHVTGLTNEEKDPEEILGFIFSKVFHAEPFIKLIGQNHAKDSQYLVPIVVDDWLGGAAT
SQHLLERHMRSAQVTFAKAPPVLIMQLPRYGQQKVFDKILPLETIDITPFVAGAVPACSK
CQACSEVYCPTCFLTRRVFYSEVIFCRKCFHHTHLLPEIEDHKSRDLYPPGKPQKKPHSH
KMVLSAVLCIETSHYVAYVRTSSNQWVFFDSMADREGLSDGFNVPVVRECGNMSDWLSLQ
GWNRLKDADECGQIKAMFGKQSSLDPLVGRLLSDSYICFYEDASPTSSSSSSSTIISSIK
NMMN
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcgaatttgcaaagtttccggagcaatcagctggatctcatcaatttcgtaac
ccactcgatgaacttacgggatcaaatacaataacaaatttaactgcacacgattttgat
tattttacacagtccgagaaaaattcaaatttatatacaagtgaaaatacaagcaattct
aacagattaaatctcaatcaaaatataccggtcggcacattaatagatggatttgagctt
attaatgaagcttctggctccggctttttagatgatcaattagtggatgttagcgattat
agccgagataggacgacgaagctggataggaataggaattctcccgagctaatagttgct
cttttgcaacgaaaagttcaaggaattcgattttcatcgaattatggaagagaggaagaa
ccatgtgttattgagatcccaccaggaacaatggttcgcgaaatggcagatgatgattgg
aaaatgtctgaattaaaagaatggttcacaaaatcaagagcttcttcgcatttacgtgat
ggattagcaatgcccatggaggaactcgactgcactcctctgatttgtgcaatgattacc
agatccgatgtaatgagaataaaccaagatcaagcaatacatcttctggctgtcagtgta
gagaaacgaatagaagtttatcaaaatttcgaatggttcaatttcattctgaatctgaaa
attggcgattctgtttctgtggaagtggacgaaacaatgcgacgggttccagcaaaagtg
tcgtggatcggtgagagaccggaagcatcaggaatatggtataatgtggactttgacggg
aacacttctcagtggccttcttcaaatcaatcatattcatcatcccatgaccgactgaat
cgtcaatttgatacgaattggaattttgaaatgtctggatcttcttcagttgcaccttcc
aattcccgtctatattattcacccaatcaaatgcatatgccaatgaaaggcggtggagtg
tcagctctatacgataatagaaggcttgtgcaatattctggagatgaagaacaatatcga
agtgcaccaaaaccggctccaagagaacgaattattccagtttcaaggcaacaaccagaa
attgaacaacggaatagtcgatctatgaaaccttctgaaccggattataatacttattcg
actcatccaccacggccgccaccatcatcatcaatgaattatccatctatgtcaaataca
cattcattacaaccaagtcgaagtaaaagtgttcaaacaattcaaagaaatcaattcgtt
cgacaaaatcctgcagaaagaaatgaacgagttgaaagtgatcaactgaactttcgaatt
ggtgatcaatgtatttggaataataatggagctgaggaaagaggaattattaaatatatt
ggtttcttgaaagggcacaaaacattatatgctggtgtcgaatttaaaaacacaattgga
gcaggcactggtgtcttcaatcgagaacagctattccttgctaaagatggtcatgctggt
ttcgttgaactttcttcactggaatcaccatcctcttctatatcatccacgtctacatca
tcatctcagcatcgtcgtcgattatcttcctcgaggagtcaacagatgccagctgcatcg
ggaacttccattagtgtcccggttaatggacgtcacaatgtgaatggaaagcaagcgtcg
atagaatcactttcggatcctccaccaccaccgtacgcaccgccatctccgccaagagca
tcgtctgccgctgcggctcaccagcaaccaccgcctttgcctccgaagccattagctaga
gtggaagattttctgattgattcgtatgatattggaagtcatgttgttgtcagacatctt
ggagcacaacgtacaggagttgttcgatggctcggcgaggaaattgacgacgaaggagat
cgaattgttcgttcagcgattgttcaactggatgaggatgttccgacggcttggcgtcga
agtcatgatgcttcctcgtacactggttctccagtagttggaggtgttcttgttccgatt
caatctctgaagcacaatcattcgggatcgtcttccaatggagcttctgtagttcagact
tcaacctatccaactagccaaacgtataataacatcagccggcgaactgaagatttcgga
agtatggattcaggagtggagaagcaaaaatgtggaattgcaaaggacatgcaacaatta
gttggcaggcagaaaggaattcagggttactgtaactcgtgttatctggatgccacgttg
tatgcaatgtttgtccaaaccacttgctttgattttcttcttgaaaaatcgatcaaagga
tcagaaacggctcaacaatttcaaaaaattctggcccacgagatcgtgttccctcttcga
aaagttcattatgtgcgagcggatcatgtcatgaaacttcgaaaattgctcgctgagctc
atgccgcatgtaacagggcttacaaatgaagaaaaagatccagaagagattcttggattc
atattctccaaagttttccatgctgagccattcataaagttgatcggacaaaatcacgca
aaagattctcaatatcttgtaccaattgtggtggatgattggctgggaggtgcagcaact
tcacagcatttgctcgaacggcatatgagatcagctcaagtaacatttgcaaaagctcct
ccagtattgattatgcaattaccaagatatggacaacagaaagtgtttgataagattctt
cctctggaaacaattgacattactccgttcgttgctggagcggttccggcttgttcaaaa
tgtcaagcatgctcagaagtctactgcccgacgtgtttcctgacgagaagagttttctat
tcggaagtgatattctgcagaaaatgtttccaccatacacatcttttgccggaaattgaa
gatcacaagagtcgagatctctacccacctggaaaaccacaaaagaaaccacactcccac
aaaatggttctctcagcggttctgtgcatagaaacatctcattacgttgcttatgttcga
acttcatcgaatcaatgggtattctttgattcgatggctgatcgagaaggactatctgat
gggttcaatgttccagtggtcagagaatgtggaaatatgtccgattggttatcactgcaa
ggatggaatcgtttgaaggatgctgatgagtgtggacagattaaggcaatgttcggcaaa
caatcatcgttggatcctctggtaggacgtctcctttccgacagttatatttgtttctac
gaggacgcctcaccgacatcttcgtcatcttcctcctctaccatcataagctcgattaaa
aatatgatgaactag

DBGET integrated database retrieval system