KEGG   Caenorhabditis elegans (nematode): CELE_F40F12.5Help
Entry
CELE_F40F12.5     CDS       T00019                                 

Gene name
cyld-1
Definition
Protein CYLD-1, isoform C
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CELE_F40F12.5 (cyld-1)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C67
   CELE_F40F12.5 (cyld-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(9898998..9899147,9899310..9899970,9900043..9900291,9900339..9900819,9900893..9901301,9901590..9901725,9901776..9901924,9902567..9902726,9902771..9902873,9903819..9903825))
Genome map
AA seq 834 aa AA seqDB search
MSGSSSVAPSNSRLYYSPNQMHMPMKGGGVSALYDNRRLVQYSGDEEQYRSAPKPAPRER
IIPVSRQQPEIEQRNSRSMKPSEPDYNTYSTHPPRPPPSSSMNYPSMSNTHSLQPSRSKS
VQTIQRNQFVRQNPAERNERVESDQLNFRIGDQCIWNNNGAEERGIIKYIGFLKGHKTLY
AGVEFKNTIGAGTGVFNREQLFLAKDGHAGFVELSSLESPSSSISSTSTSSSQHRRRLSS
SRSQQMPAASGTSISVPVNGRHNVNGKQASIESLSDPPPPPYAPPSPPRASSAAAAHQQP
PPLPPKPLARVEDFLIDSYDIGSHVVVRHLGAQRTGVVRWLGEEIDDEGDRIVRSAIVQL
DEDVPTAWRRSHDASSYTGSPVVGGVLVPIQSLKHNHSGSSSNGASVVQTSTYPTSQTYN
NISRRTEDFGSMDSGVEKQKCGIAKDMQQLVGRQKGIQGYCNSCYLDATLYAMFVQTTCF
DFLLEKSIKGSETAQQFQKILAHEIVFPLRKVHYVRADHVMKLRKLLAELMPHVTGLTNE
EKDPEEILGFIFSKVFHAEPFIKLIGQNHAKDSQYLVPIVVDDWLGGAATSQHLLERHMR
SAQVTFAKAPPVLIMQLPRYGQQKVFDKILPLETIDITPFVAGAVPACSKCQACSEVYCP
TCFLTRRVFYSEVIFCRKCFHHTHLLPEIEDHKSRDLYPPGKPQKKPHSHKMVLSAVLCI
ETSHYVAYVRTSSNQWVFFDSMADREGLSDGFNVPVVRECGNMSDWLSLQGWNRLKDADE
CGQIKAMFGKQSSLDPLVGRLLSDSYICFYEDASPTSSSSSSSTIISSIKNMMN
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgtctggatcttcttcagttgcaccttccaattcccgtctatattattcacccaatcaa
atgcatatgccaatgaaaggcggtggagtgtcagctctatacgataatagaaggcttgtg
caatattctggagatgaagaacaatatcgaagtgcaccaaaaccggctccaagagaacga
attattccagtttcaaggcaacaaccagaaattgaacaacggaatagtcgatctatgaaa
ccttctgaaccggattataatacttattcgactcatccaccacggccgccaccatcatca
tcaatgaattatccatctatgtcaaatacacattcattacaaccaagtcgaagtaaaagt
gttcaaacaattcaaagaaatcaattcgttcgacaaaatcctgcagaaagaaatgaacga
gttgaaagtgatcaactgaactttcgaattggtgatcaatgtatttggaataataatgga
gctgaggaaagaggaattattaaatatattggtttcttgaaagggcacaaaacattatat
gctggtgtcgaatttaaaaacacaattggagcaggcactggtgtcttcaatcgagaacag
ctattccttgctaaagatggtcatgctggtttcgttgaactttcttcactggaatcacca
tcctcttctatatcatccacgtctacatcatcatctcagcatcgtcgtcgattatcttcc
tcgaggagtcaacagatgccagctgcatcgggaacttccattagtgtcccggttaatgga
cgtcacaatgtgaatggaaagcaagcgtcgatagaatcactttcggatcctccaccacca
ccgtacgcaccgccatctccgccaagagcatcgtctgccgctgcggctcaccagcaacca
ccgcctttgcctccgaagccattagctagagtggaagattttctgattgattcgtatgat
attggaagtcatgttgttgtcagacatcttggagcacaacgtacaggagttgttcgatgg
ctcggcgaggaaattgacgacgaaggagatcgaattgttcgttcagcgattgttcaactg
gatgaggatgttccgacggcttggcgtcgaagtcatgatgcttcctcgtacactggttct
ccagtagttggaggtgttcttgttccgattcaatctctgaagcacaatcattcgggatcg
tcttccaatggagcttctgtagttcagacttcaacctatccaactagccaaacgtataat
aacatcagccggcgaactgaagatttcggaagtatggattcaggagtggagaagcaaaaa
tgtggaattgcaaaggacatgcaacaattagttggcaggcagaaaggaattcagggttac
tgtaactcgtgttatctggatgccacgttgtatgcaatgtttgtccaaaccacttgcttt
gattttcttcttgaaaaatcgatcaaaggatcagaaacggctcaacaatttcaaaaaatt
ctggcccacgagatcgtgttccctcttcgaaaagttcattatgtgcgagcggatcatgtc
atgaaacttcgaaaattgctcgctgagctcatgccgcatgtaacagggcttacaaatgaa
gaaaaagatccagaagagattcttggattcatattctccaaagttttccatgctgagcca
ttcataaagttgatcggacaaaatcacgcaaaagattctcaatatcttgtaccaattgtg
gtggatgattggctgggaggtgcagcaacttcacagcatttgctcgaacggcatatgaga
tcagctcaagtaacatttgcaaaagctcctccagtattgattatgcaattaccaagatat
ggacaacagaaagtgtttgataagattcttcctctggaaacaattgacattactccgttc
gttgctggagcggttccggcttgttcaaaatgtcaagcatgctcagaagtctactgcccg
acgtgtttcctgacgagaagagttttctattcggaagtgatattctgcagaaaatgtttc
caccatacacatcttttgccggaaattgaagatcacaagagtcgagatctctacccacct
ggaaaaccacaaaagaaaccacactcccacaaaatggttctctcagcggttctgtgcata
gaaacatctcattacgttgcttatgttcgaacttcatcgaatcaatgggtattctttgat
tcgatggctgatcgagaaggactatctgatgggttcaatgttccagtggtcagagaatgt
ggaaatatgtccgattggttatcactgcaaggatggaatcgtttgaaggatgctgatgag
tgtggacagattaaggcaatgttcggcaaacaatcatcgttggatcctctggtaggacgt
ctcctttccgacagttatatttgtttctacgaggacgcctcaccgacatcttcgtcatct
tcctcctctaccatcataagctcgattaaaaatatgatgaactag

DBGET integrated database retrieval system