KEGG   Caenorhabditis elegans (nematode): CELE_F42A10.4Help
Entry
CELE_F42A10.4     CDS       T00019                                 

Gene name
efk-1
Definition
Protein EFK-1, isoform B
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(6165237..6165501,6166099..6166243,6166467..6167202,6167256..6168332,6168419..6168478))
Genome map
AA seq 760 aa AA seqDB search
MTIDTTNESDNSPTNSPGLEASARTFSLNASKMVRITDDYADEVFIEQNDVVIEKPRMDP
LHVRKLMETWRKAARRARTNYIDPWDEFNIHEYPVQRAKRYRYSAIRKQWTEDIVDVRLH
PDSFARGAMRECYRLKKCSKHGTSQDWSSNYVAKRYICQVDRRVLFDDVRLQMDAKLWAE
EYNRYNPPKKIDIVQMCVIEMIDVKGSPLYHLEHFIEGKYIKYNSNSGFVSNAARLTPQA
FSHFTFERSGHQMMVVDIQGVGDLYTDPQIHTVVGTDYGDGNLGTRGMALFFHSHRCNDI
CETMDLSNFELSPPEIEATEVAMEVAAKQKKSCIVPPTVFEARRNRISSECVHVEHGISM
DQLRKRKTLNQSSTDLSAKSHNEDCVCPECIPVVEQLCEPCSEDEEDEEEDYPRSEKSGN
SQKSRRSRMSISTRSSGDESASRPRKCGFVDLNSLRQRHDSFRSSVGTYSMNSSRQTRDT
EKDEFWKVLRKQSVPANILSLQLQQMAANLENDEDVPQVTGHQFSVLGQIHIDLSRYHEL
GRFVEVDSEHKEMLEGSENDARVPIKYDKQSAIFHLDIARKCGILEAVLTSAHIVLGLPH
ELLKEVTVDDLFPNGFGEQENGIRDLEEFGSDLMEIAAEMGDKGAMLYMAHAYETGQHLG
PNRRTDYKKSIDWYQRVVGFQEEEELDSDCGKTTFSSFAPLTRHEILAKMAEMYKEGGYG
LNQDFERAYGLFNEAAEAAMEAMNGKLANKYYEKAEMCGE
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgacacaacaaatgagagcgacaatagtccaactaactcaccaggattggag
gcctcggctcggacattctcgctcaatgcgtcaaaaatggttcggataaccgacgactac
gcagatgaagtgttcattgaacagaatgatgtcgttatcgagaagcctcgtatggatcct
ctccacgttagaaaacttatggagacatggcgcaaggctgctcgccgagcaagaacaaac
tatatagatccatgggatgagttcaacatccacgagtatccagtacaacgagctaaacga
tataggtattctgcaatcagaaagcaatggacagaggatatagtcgatgtgagacttcat
ccggacagttttgcacgtggagccatgcgagaatgctaccgactcaaaaagtgctccaag
cacggaacaagtcaagattggagcagcaactatgtcgcaaaaagatacatttgtcaagtc
gatcgtagagttcttttcgatgatgtcagacttcagatggatgccaaattatgggctgaa
gaatataatcggtataatccaccgaagaaaattgatattgttcaaatgtgtgtcattgag
atgattgatgtaaaaggttctccactctatcatttggagcatttcatcgagggaaaatat
ataaaatacaattcaaactcaggatttgtatcaaatgcagctcgtcttacaccacaagca
ttttctcacttcaccttcgaacgttctggtcatcaaatgatggttgtcgatattcaagga
gttggtgatctttacacagatcctcagattcatacagttgtgggaactgattatggagat
ggaaacctcggaactcgtggaatggctcttttcttccattcacacagatgtaacgatatt
tgtgagacaatggatctatcaaatttcgaactttcgccacctgaaatcgaggctaccgaa
gttgcgatggaagtagctgcaaagcagaaaaagtcatgcatagttcctccaactgtgttc
gaagcaagaagaaatcgaatttcaagtgaatgtgtacatgtcgagcatggtatttcgatg
gatcaattgagaaaaaggaagacgttgaatcaatcgtcaaccgatttgtcagcaaagagt
cacaacgaagactgtgtatgtcctgagtgtattccagttgttgagcaactctgtgagcct
tgctccgaagatgaagaggacgaagaagaagactatccaagaagtgaaaaaagtggaaat
agtcagaaaagtcgacgtagtagaatgagcatttcaacgagatcttctggcgatgaatca
gcatctcgtcctagaaaatgcggatttgtagatttaaactcacttcgtcagagacatgat
agcttcagaagttctgttgggacatattctatgaatagttctagacaaaccagagacact
gaaaaggatgaattctggaaggttcttcgaaaacaatcagttccagcaaacattctatca
cttcaacttcaacaaatggctgctaacctggaaaatgatgaagacgtaccacaagtcacc
gggcatcagttctctgtcctcggtcagattcatattgatctctcacgatatcatgagctc
gggcggttcgtagaagttgattcagaacataaggaaatgcttgagggaagtgaaaatgac
gctcgtgtaccaatcaaatacgacaagcagtctgcaattttccatttggatatcgctcgg
aagtgtggaatccttgaggctgtgctaacatcggctcatattgttctcggattaccacat
gaattgttgaaagaagtcaccgttgatgatctgtttcctaatgggtttggagaacaggaa
aatggaattcgagacctagaagagttcggctccgatctgatggaaattgctgcagagatg
ggtgataagggtgcaatgctgtacatggcacacgcttatgaaactggtcagcatctcgga
ccgaatcgaagaacggattataagaaatcgattgattggtatcaacgcgtcgttggattc
caagaagaagaagaacttgactctgattgtggaaaaacgacattctcctcatttgctcca
ctgactcgtcacgagattctagccaaaatggctgaaatgtacaaagagggaggttatggc
ctgaatcaagacttcgaacgagcatatggtctattcaatgaagctgctgaagcagcaatg
gaagcaatgaatggaaagctcgcaaataaatactatgaaaaagcggaaatgtgtggagaa
tga

DBGET integrated database retrieval system