KEGG   Caenorhabditis elegans (nematode): CELE_F42A10.8Help
Entry
CELE_F42A10.8     CDS       T00019                                 

Gene name
nas-28
Definition
Protein NAS-28
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_F42A10.8 (nas-28)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_F42A10.8 (nas-28)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(6181078..6181237,6181288..6181511,6181560..6181711,6181883..6182014,6182059..6182260,6182353..6182472,6182519..6182589,6182637..6182801,6182848..6182917,6183021..6183218))
Genome map
AA seq 497 aa AA seqDB search
MFFPVVFFIPFVLGAPTQKALEKILVDNNPDSVTNREKIRGIIDKAFENRVPRVQGRQGV
APPVTFAALNYGPKNNQTKKFEELNQDINEYTFESDIMLNEKQAKHIATAIENGNYRSKR
QAIVDTTNFWSVSVPIFYQFDTKLSATNIANVRKAIQFWNDNSCLSFKEDNNAKNRLFLS
SAGGCWSYVGKQVDMPYQMVSVGPNCDTFGTATHELMHAIGFWHQQSRADRDNYVYVDFS
NIIPSQAYNFQKMAVDQAQLLNLPYDYGSVMQYYPYAFAVDSSKYTILAKENGFQNSMGQ
REAPAFSDIIGVNKLYNCTSQCKIQMKCSNCGITDSRNCNQCKCPRYFTGASCDSLPSGT
APNCNGAVLQATSSWETFDAKAGDPSSFSSSTDNSTNCYWHIKAPEGQQIEFKMTKTPLA
AICMQECPWQSIEVNLGKFDLFGMITCCDTILNQVFTSELNMIALRGIIRYNQLTFSIQY
RAVPSSKPASTNACLNQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgttcttccccgttgtattcttcatccctttcgtgctgggtgccccgactcaaaaggcc
ctggaaaagattctggtggacaataatcctgattcagttacaaatcgagagaagattcgt
ggaattatcgataaggcgtttgagaatcgtgttccgagggttcaaggaagacaaggtgtt
gctcctcctgttactttcgctgccttaaactacggtccaaagaacaatcagacaaagaaa
tttgaagaactgaatcaagatatcaacgaatacacatttgaatctgacatcatgctgaat
gagaaacaagccaaacacattgcaactgcaattgaaaatggaaattatcgatcaaagagg
caagcgattgtagatactaccaatttttggagtgtcagtgttccgatcttttatcaattt
gatactaaattatccgccaccaacatagccaatgtcagaaaagcaattcaattttggaat
gataacagctgtctgagcttcaaggaagacaataatgctaaaaaccgtctctttttatca
tctgcaggaggatgttggtcatatgtcggaaagcaagttgacatgccataccaaatggtt
tcagttgggccaaactgtgatacgtttggtactgcaacccacgagctcatgcatgccatt
ggcttctggcaccaacaatcacgcgccgatcgggataactacgtctatgtggactttagc
aatatcattccaagtcaggcatacaattttcaaaaaatggcagtggatcaggcacagctg
ttgaatttgccatatgattatggaagtgttatgcagtattacccatatgcatttgctgtt
gactcatcgaagtatacaattttggcaaaggagaatggattccagaatagtatgggacaa
cgagaggcaccagcattttcagatattatcggagtgaacaagttgtacaattgcacaagc
caatgcaagatacaaatgaagtgttcaaattgtggaatcacagactcccgtaactgtaat
caatgcaaatgtccgcgctatttcacaggagctagctgcgatagcttaccatctggtact
gctccaaattgtaatggagccgtgcttcaggctacatcctcttgggaaaccttcgacgca
aaagccggagacccatccagcttctcttcttccacagacaattcgaccaattgttactgg
catatcaaagctccagaaggacaacaaattgaattcaaaatgacaaaaactccattggca
gcaatatgtatgcaagaatgtccatggcaatcgattgaagttaatcttggaaagtttgac
ttatttggaatgataacctgctgtgacacaatcctaaaccaagtgttcacctctgagctt
aatatgattgctcttcgtggaataattcgctacaatcagttgacgtttagcattcaatat
cgagcagtgccaagttcgaagcctgcttcaaccaatgcttgcttgaaccagtga

DBGET integrated database retrieval system