KEGG   Caenorhabditis elegans (nematode): CELE_F42A9.5Help
Entry
CELE_F42A9.5      CDS       T00019                                 

Gene name
cyp-33E2
Definition
Protein CYP-33E2
Orthology
K17955  
cytochrome P450, family 33
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Cytochrome P450 [BR:cel00199]
 Cytochrome P450, animal type
  CYP33 family
   CELE_F42A9.5 (cyp-33E2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(8612580..8612661,8612712..8612796,8612845..8612993,8613041..8613153,8613198..8613329,8613375..8613510,8613556..8613718,8613785..8613995,8614154..8614291,8614339..8614614)
Genome map
AA seq 494 aa AA seqDB search
MILFIVLSIVSIYLFDLFYWKRRNLPPGPLPLPLVGNLHMMSDDVKPGYSLFSNLKEQYG
HVYTFWMASLPIVHVTDWNLIKQHFIKDGGNFVGRPEFPMSIELRQGPYGIIESHGDRWV
QQRRFALHVLRDFGLGKNLMEEKVLGEVTAMLDRLRKTMDEVDMQSVFDASVGSVINNLL
FGYRYDETNIAEFLDLKEKLNNHFQLAAKPIGGLIGMNPWLGYFPYFSGYKNVMIQNWMG
LVEMFRKQANEKLATIDYESDDYSDYVEAFLKERKKHENEKDFGGFEMEQLDSVCFDLWV
AGMETTSNTLNWALLYVLRNPEVRQKVYEELDREIGSDRIITTSDKPKLNYINATINESQ
RLANLLPMNLARSTTKDVEIAGYHIKKNTVIIPQISLVLYNPEIFPEPYEFKPERFLESD
GSLKKVEELVPFSIGKRQCPGEGLAKMELLLFFANLFNRFDIQLHQSNPNPSVEKEFGVT
MKAKSYRLKLKDRH
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatattatttattgttctatctattgtttcaatctacctcttcgacttattctactgg
aaacgaaggaatttgccaccaggaccacttccactgccattagttggaaacttgcacatg
atgagtgatgatgttaagccaggatattctttgttttcaaatttaaaagaacagtatggt
catgtgtatacattttggatggctagtctccctatagttcatgtcaccgattggaatcta
attaaacaacattttataaaagatggaggaaattttgttggaagaccagaattccctatg
tccattgagctgagacagggtccatatggaatcattgaatctcatggtgatcgatgggtt
caacagagacggtttgcattacatgttctcagggattttggattgggaaagaatttgatg
gaagaaaaggttcttggagaggtgactgcaatgttggatagactacgcaaaactatggat
gaagtggatatgcagagtgtatttgatgcatcagttggatctgtgattaataatttactt
tttgggtatcgatatgatgaaacgaacatagcggaatttttggatcttaaagaaaaattg
aacaatcacttccaattagccgcaaagccaattggaggtcttattggaatgaacccgtgg
cttggatatttcccttatttcagcggatacaagaatgtcatgattcaaaactggatgggt
cttgtcgaaatgttccggaaacaggcaaatgagaagttggcaacaattgattatgaatcg
gacgactattcagactatgttgaagcatttttgaaagagagaaaaaaacacgaaaatgaa
aaagactttggaggttttgaaatggaacaacttgatagtgtatgttttgatctctgggtt
gctggaatggaaacaacttcaaatactctcaattgggcacttctttatgtcctccgaaat
ccagaagtacgccaaaaagtgtatgaagaattggatagagaaattggaagtgataggatt
attacaacttctgataaacctaaactcaactatatcaatgcaactattaatgaatcacaa
cgtcttgccaatcttctcccgatgaatctagccagatccacaacaaaagacgtggagatt
gcgggttatcatattaaaaagaatacagtcataattccacaaatcagtttggttttgtat
aatccagaaatcttccctgaaccatacgagtttaaaccggaaagattcctagaatcggat
ggaagtttgaaaaaagtcgaagagcttgttccattttcgattggaaaacgacagtgtccc
ggcgaaggacttgccaaaatggaattattattattctttgctaatttattcaatagattc
gatattcaattacaccagtcaaatccgaatccaagtgtggaaaaagagtttggagtgact
atgaaagcaaagagttaccgattgaaactgaaagacagacattaa

DBGET integrated database retrieval system