KEGG   Caenorhabditis elegans (nematode): CELE_F42F12.3Help
Entry
CELE_F42F12.3     CDS       T00019                                 

Gene name
F42F12.3
Definition
Protein F42F12.3
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CELE_F42F12.3 (F42F12.3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(12350588..12350841,12350891..12351048,12351187..12351439,12351526..12351592)
Genome map
AA seq 243 aa AA seqDB search
MRETILMMAWAMIGTAFFVFFALKMGLTAGYGRYTNQAQWGINPKLAWFIQESPAFFIPF
YFLFGGLSSTGRILNCIFLVHYFYRALIYPFRIRSTTKSPLLIVAAAVAFCTYNGTLQGV
WNSYYQLEEELTYRHLIGSILYFSGMFINHKSDNILMTLRKPGETGYKIPTGFLYEYISC
PNYFGEIMEWIGYAILGWNLPALAFAIFTFANIGPRAIAHHNWYKEKFPKYPPTRRALIP
YIY
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaaacaattctcatgatggcttgggccatgattggcactgctttctttgtcttt
tttgctctaaaaatggggcttactgctggatacggaagatacaccaaccaggcacaatgg
ggaatcaatccgaaactcgcatggtttatccaagagtctcccgcttttttcattcctttc
tatttcttgtttggtggactatcttcaactggacgtattttgaattgcatttttctcgtt
cattatttctacagggccttgatctatccgttccgcatccgatcgactacaaagtctcca
ctcttaattgttgccgctgcagtagccttctgtacatacaacgggaccttgcaaggagtt
tggaattcctactatcaactggaggaagaattgacataccgtcatcttattggatctatt
ctctatttctctggaatgtttatcaaccacaagtcagacaacatcctgatgacgttacgc
aagcctggagagactgggtacaaaattccaactggatttttgtacgagtacatctcatgt
cccaattattttggagaaatcatggaatggatcggctacgcaatcctcggctggaacctt
cctgcactcgcgttcgcgatcttcacgtttgcgaacattggcccaagagcgattgcacat
cacaattggtacaaggagaagttcccgaaatacccaccaacgcgtcgtgccctaattccg
tacatctattaa

DBGET integrated database retrieval system