KEGG   Caenorhabditis elegans (nematode): CELE_F42F12.4Help
Entry
CELE_F42F12.4     CDS       T00019                                 

Gene name
F42F12.4
Definition
(RefSeq) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00270  Cysteine and methionine metabolism
cel01100  Metabolic pathways
Module
cel_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CELE_F42F12.4 (F42F12.4)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     CELE_F42F12.4 (F42F12.4)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     CELE_F42F12.4 (F42F12.4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_8 Cupin_6
Motif
Other DBs
NCBI-GeneID: 181393
NCBI-ProteinID: NP_510072
WormBase: WBGene00009636
Ensembl: WBGene00009636
UniProt: Q20340
Position
X:complement(join(12352064..12352183,12352241..12352327,12352526..12352618,12352667..12352786,12352829..12352945))
Genome map
AA seq 178 aa AA seqDB search
MAYFMTDVTKENRQDECRFSPNKEATEEDLLRIGVECTKVNFDDEHVQEDLDRLIKKYDM
NFHDEVHICRATMPNFDEKLDIFFEEHLHDDAELRVIKHGVGFFDVRTKDEAWIRIPVRR
GDFVFLPAGIYHRFTTDPSEDVVALRLFRNNPKWTAFNRKADGDEQRVRQQYLNDISA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatttcatgactgatgttaccaaggaaaatcgccaagatgaatgcagattttcg
ccgaacaaagaagctaccgaagaagatcttttgcgaattggagtcgaatgcacaaaagtc
aactttgatgacgaacatgttcaagaggacttggatcgtcttatcaagaaatatgacatg
aattttcacgacgaagttcatatttgtcgtgccaccatgccgaatttcgatgaaaaactt
gacatcttctttgaagaacatcttcacgatgatgcggaacttcgtgtaattaagcatggc
gttgggttctttgacgtcagaacaaaagacgaagcttggatccgcatcccagttcgtcga
ggagactttgtttttcttcccgcaggaatctaccatcgcttcactaccgatccttcggaa
gacgtcgttgctctgagacttttccgaaataatcccaagtggactgcattcaaccgcaaa
gctgatggagatgagcaacgagttcgccagcaatatttgaacgatatttctgcttaa

DBGET integrated database retrieval system