KEGG   Caenorhabditis elegans (nematode): CELE_F42G10.2Help
Entry
CELE_F42G10.2     CDS       T00019                                 

Gene name
mkk-4
Definition
Protein MKK-4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_F42G10.2 (mkk-4)
   04012 ErbB signaling pathway
    CELE_F42G10.2 (mkk-4)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CELE_F42G10.2 (mkk-4)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CELE_F42G10.2 (mkk-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(10027861..10027985,10028039..10028198,10028243..10028365,10028479..10028598,10028645..10028824,10029077..10029145,10029190..10029255,10029306..10029391,10029446..10029511,10029561..10029657)
Genome map
AA seq 363 aa AA seqDB search
MVQEDDENLRNSMSLRPTSLSTRPTSLSVNGNEKTLPEESVLRSLSTGTLKYPDDEHLYT
FSSANLQDLGAIGNGNFGTVYKMRHKETGKLIAVKRIRCNNIGHREQIRLLREHDTIVKS
EKGPNIVKFYGAIFSEGDCWICMELMDISMDLLYKRVYMVKNSRLNENVVGHITVCTVDA
LDYLKKELKIIHRDVKPSNILVDGTGAVKLCDFGICGQLEESFAKTHDAGCQPYLAPERI
TSSDKYDVRSDVWSLGITLYEIATGKFPYQEWNSLFDQIATVVSGDPPILHPDSDDFHYS
LPLVKFINTCLTKDRRHRPKYDTLKSFDFYRIYAVAGPEIEEAKRILGVEAIDTRNHPVD
HRG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagaagatgacgagaatttacgcaattcaatgtcccttcggccgacttcgttg
tcaacacgtcccacatcactttcggtaaacggaaatgagaagacgcttccagaagaaagt
gtgttacgttctctttcgacaggcacattaaaataccctgatgacgaacatttatacaca
ttcagctccgctaatttacaagatcttggagcaattggaaacggcaattttggaacagtt
tacaaaatgcgtcacaaagaaactggaaaactgatagctgtgaagaggatacgatgcaac
aacattggacatagagaacaaatccgcttacttcgagagcacgacacaattgtgaaatcc
gagaaaggaccaaatatcgtgaagttttacggagcgattttcagcgagggtgattgctgg
atttgcatggaactgatggacatttcgatggaccttctttataaacgagtatatatggtg
aaaaatagtcggctgaatgaaaatgtcgtcggacatatcacagtttgcactgtagatgca
ttggattatttgaagaaagaattaaaaattattcatcgagacgtgaaaccctccaatatt
cttgtagacggaactggagcagtgaaactttgcgattttggtatttgtgggcagttagaa
gaatcatttgcgaaaactcatgacgccggttgtcagccgtatcttgcacccgaaaggatt
acaagttcagacaaatatgatgtgagatcggatgtgtggtcattgggaataactttgtac
gaaatagcaacaggaaaatttccctaccaagaatggaattcactttttgatcagattgct
acagtagtaagcggtgatcctccaattctacatccagacagcgacgatttccattacagt
ttgccgcttgtcaagtttatcaatacttgcttaactaaagacagacgccatcggcccaaa
tatgatactctgaagagttttgacttttatagaatatacgcagttgccggacccgaaatt
gaagaggctaagcgaattcttggagttgaagcaattgacacaagaaatcatcctgtcgac
cacagaggatag

DBGET integrated database retrieval system