KEGG   Caenorhabditis elegans (nematode): CELE_F42G8.3Help
Entry
CELE_F42G8.3      CDS       T00019                                 

Gene name
pmk-2
Definition
Protein PMK-2, isoform A
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cel04010]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cel04068]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(8143497..8143601,8144199..8144284,8144334..8144522,8145028..8145139,8147039..8147282,8147611..8147682,8147732..8147828,8147913..8148117,8148168..8148317)
Genome map
AA seq 419 aa AA seqDB search
MGMSATMGDSASIPGVFFADFGPAPPEITPEGYHEVELNKTKWVLPQWYNSLKPLGEGAY
GVVCTAEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPD
ASSLNNVYFVSVLMGSDLQNIMKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSN
IAVNERCEVKVFLSFSQLSFLILSFFKILDFGLARAQDAEMTGYVATRWYRAPEIMLNWM
HYTQTVDVWSVGCILAELVSGRPLFPGDDHIDQLTKIMSVVGTPKEEFWSKIQSEEARNY
IKNRSPIIRQDFVTLFPMASPYALELLEMMLILDPDRRISVSSALRHDYLREYSVPNDEP
VAMDTVINSIVTIDPAEERATTLSDWRELIWNEIRLFQNSARRLSFVSCTDTEEEPMKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggggatgtcggcgaccatgggcgattcagccagcattcccggtgtcttttttgccgat
tttggtcctgccccgcctgagattactccagaaggatatcatgaggtcgaactaaacaaa
acgaaatgggtcttacctcaatggtacaacagtttgaagcctctaggagaaggagcgtat
ggagttgtatgcacagcagaatatgagccaactggagatcgagttgcaattaaaaagttc
tttcgcccatttcaaagtacaattcacgcaaaacgaacctatcgggaactgaaacttcta
agaactctacaacatgataatgtattggaaatgattgatgtattcacaccagatccagat
gcatcttctttgaataatgtatatttcgtatccgttctgatgggctccgatttacaaaat
attatgaaaatccaacgactgaccgatgaacaaatccaactgcttatctatcaagtgtta
cgtgggctcaagtatatccattcggcagggattatccatcgcgatttaaaaccatcgaat
attgctgtcaatgagagatgcgaagtcaaggtttttcttagtttttctcaactttctttc
ctaattctttcatttttcaagattctcgattttggattggctcgtgctcaagacgccgaa
atgactggatacgtggcaacaagatggtacagagctccagagattatgctcaattggatg
cattatacacagactgttgatgtttggtcagttggatgtattcttgcggaactggtatcc
gggagaccattgtttccaggcgatgatcatattgatcagctaacaaagataatgtcagtt
gtgggtaccccaaaagaagaattctggtccaaaattcaatcagaagaagctcgaaattat
attaaaaatcgttctccaattatccgtcaggacttcgttacattgtttccaatggcttct
ccatatgctctcgaacttctcgaaatgatgctaattttggatccggacagaagaatttct
gtatcaagtgctcttcgtcatgactatcttcgtgaatactctgtgccaaatgatgaacca
gttgcaatggatacggtaataaatagcatagtcacaattgatccagctgaagaacgagca
acaacgttatccgactggcgagagttaatttggaatgagattcgattattccaaaactcg
gcacgaagactaagttttgtaagctgtacggatacggaagaagagccaatgaaaatatga

DBGET integrated database retrieval system