KEGG   Caenorhabditis elegans (nematode): CELE_F42G8.3Help
Entry
CELE_F42G8.3      CDS       T00019                                 

Gene name
pmk-2
Definition
(RefSeq) Mitogen-activated protein kinase pmk-2
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04068  FoxO signaling pathway
cel04212  Longevity regulating pathway - worm
cel04933  AGE-RAGE signaling pathway in diabetic complications
Module
cel_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_F42G8.3 (pmk-2)
   04068 FoxO signaling pathway
    CELE_F42G8.3 (pmk-2)
 Organismal Systems
  Aging
   04212 Longevity regulating pathway - worm
    CELE_F42G8.3 (pmk-2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    CELE_F42G8.3 (pmk-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_F42G8.3 (pmk-2)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CELE_F42G8.3 (pmk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase APH FTA2
Motif
Other DBs
NCBI-GeneID: 177611
NCBI-ProteinID: NP_741457
WormBase: WBGene00004056
UniProt: Q8MXI4
Position
IV:join(8143511..8143615,8144213..8144298,8144348..8144536,8145042..8145153,8147053..8147130,8147182..8147296,8147625..8147696,8147746..8147842,8147927..8148131,8148182..8148331)
Genome map
AA seq 402 aa AA seqDB search
MGMSATMGDSASIPGVFFADFGPAPPEITPEGYHEVELNKTKWVLPQWYNSLKPLGEGAY
GVVCTAEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPD
ASSLNNVYFVSVLMGSDLQNIMKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSN
IAVNERCEVKILDFGLARAQDAEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAE
LVSGRPLFPGDDHIDQLTKIMSVVGTPKEEFWSKIQSEEARNYIKNRSPIIRQDFVTLFP
MASPYALELLEMMLILDPDRRISVSSALRHDYLREYSVPNDEPVAMDTVINSIVTIDPAE
ERATTLSDWRELIWNEIRLFQNSARRLSFVSCTDTEEEPMKI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggggatgtcggcgaccatgggcgattcagccagcattcccggtgtcttttttgccgat
tttggtcctgccccgcctgagattactccagaaggatatcatgaggtcgaactaaacaaa
acgaaatgggtcttacctcaatggtacaacagtttgaagcctctaggagaaggagcgtat
ggagttgtatgcacagcagaatatgagccaactggagatcgagttgcaattaaaaagttc
tttcgcccatttcaaagtacaattcacgcaaaacgaacctatcgggaactgaaacttcta
agaactctacaacatgataatgtattggaaatgattgatgtattcacaccagatccagat
gcatcttctttgaataatgtatatttcgtatccgttctgatgggctccgatttacaaaat
attatgaaaatccaacgactgaccgatgaacaaatccaactgcttatctatcaagtgtta
cgtgggctcaagtatatccattcggcagggattatccatcgcgatttaaaaccatcgaat
attgctgtcaatgagagatgcgaagtcaagattctcgattttggattggctcgtgctcaa
gacgccgaaatgactggatacgtggcaacaagatggtacagagctccagagattatgctc
aattggatgcattatacacagactgttgatgtttggtcagttggatgtattcttgcggaa
ctggtatccgggagaccattgtttccaggcgatgatcatattgatcagctaacaaagata
atgtcagttgtgggtaccccaaaagaagaattctggtccaaaattcaatcagaagaagct
cgaaattatattaaaaatcgttctccaattatccgtcaggacttcgttacattgtttcca
atggcttctccatatgctctcgaacttctcgaaatgatgctaattttggatccggacaga
agaatttctgtatcaagtgctcttcgtcatgactatcttcgtgaatactctgtgccaaat
gatgaaccagttgcaatggatacggtaataaatagcatagtcacaattgatccagctgaa
gaacgagcaacaacgttatccgactggcgagagttaatttggaatgagattcgattattc
caaaactcggcacgaagactaagttttgtaagctgtacggatacggaagaagagccaatg
aaaatatga

DBGET integrated database retrieval system