KEGG   Caenorhabditis elegans (nematode): CELE_F42G8.4Help
Entry
CELE_F42G8.4      CDS       T00019                                 

Gene name
pmk-3
Definition
Protein PMK-3
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_F42G8.4 (pmk-3)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CELE_F42G8.4 (pmk-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(8140232..8140483,8140967..8141112,8141163..8141247,8141546..8141655,8141701..8141848,8142022..8142628,8142710..8142786)
Genome map
AA seq 474 aa AA seqDB search
MASVPSSSSLPVSHVRRHEDVSTPSAPPTKRSNNQSQPPESYEPNTWLQQQREQEQQKKL
AAENIKKQSIEATGNNEMVGEEEEDILSKPCGPHKRRFQFVMIRNITFAIPEGYDVEPNS
IEYLGGGSFGNVIKTSAVCRDGLRRYVAIKKMREPFFDPHHARRIFRETKLLQLMRHDNI
ICALDIYTPDEENDFRDVYVVTEFAGRSLYQILKQQRDYGRRVLTDEHIKFIIYQIIRAL
KYIHSANIIHRDLKPGNLALTDDSDLMILDFGLARSLEKKDTSLTQYVQTRWYRSPEVIY
WKIDSYTNLADMWSLGCIAAELLTGEPLFPGDEPNAQYQRITQLCGSPDEELLTKIENDN
SSAIKAVIQSYTTHKRRNFRDVFSAHNPSEDFIDLLEKLLVLDPEKRITVEEAIQHPYLA
EFSLPEDEPRADHIFDLDDSQARTRFEWRDAVWKEIMNYKRLSSSPLIPGEADR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagtcccatcgtcatctagtctcccagtgtcgcatgtccgtcgtcatgaagac
gtgtcaacaccaagtgcaccaccaaccaaacgaagtaataatcaatctcaacctccagaa
agctacgaacccaacacctggttgcaacaacaacgagagcaggaacaacagaaaaagtta
gctgcagagaatattaagaagcagagtatcgaagcaacgggaaacaacgagatggttggg
gaggaggaagaggatattctctcaaaaccatgtggtccacacaaacgacgattccaattt
gtgatgatccgtaacattacatttgcaattccggaaggctatgacgtcgagccaaacagc
attgagtatttgggtggaggctcgtttggaaatgttataaaaacaagtgcagtgtgccgt
gacgggcttcgtcgttatgttgcaataaagaagatgcgagaaccgttctttgatccacat
catgctcgtcgcatcttccgtgaaacaaaacttcttcaattaatgagacatgacaatatc
atctgtgctcttgacatctacacacctgacgaggaaaacgattttcgagatgtatacgtt
gtcactgaatttgcgggtcgtagtctttatcagatcttgaagcaacaaagagattatgga
cggcgcgtgctgaccgacgagcatatcaaattcatcatttatcaaatcatacgtgcactt
aagtacattcattctgctaatattatacatcgtgacttgaaaccaggaaatctcgcgttg
accgatgattctgacctcatgattctcgattttggacttgcaagatccttggaaaagaaa
gatacttctctaacacaatatgtacaaacaagatggtaccgtagtccagaagtcatttat
tggaagattgatagttacacaaatctggcagatatgtggtcacttggatgtattgctgca
gaacttttaactggagaaccactgtttccgggtgatgagcccaatgctcaatatcaacgt
attactcaattatgtggaagtcctgatgaagaacttttgacaaagattgaaaatgataac
tcgtctgcaattaaagccgtaattcaatcctacacaactcacaaacgtcgaaatttccgt
gatgtattttctgctcataatccatcagaagactttattgatctacttgagaagctttta
gttttggatccagagaagaggattacggtggaagaagctattcaacatccatatttggca
gagttttcacttccagaagatgaaccaagagctgatcatatatttgacttggatgactct
caagctagaacaagattcgagtggagagatgccgtctggaaggaaataatgaactacaaa
agactcagctcatcaccgttaatccctggagaagcagatcgctga

DBGET integrated database retrieval system