KEGG   Caenorhabditis elegans (nematode): CELE_F43C1.2Help
Entry
CELE_F43C1.2      CDS       T00019                                 

Gene name
mpk-1
Definition
Protein MPK-1, isoform B
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cel04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cel04012]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:cel04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cel04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cel04150]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:cel04320]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(4217369..4217588,4218054..4218653,4219051..4219106,4219161..4219287,4219438..4219496,4219548..4219616,4227864..4228067))
Genome map
AA seq 444 aa AA seqDB search
MPTWIPNNLCAQPTTRNAKPPSNGHPQATQQQSAPGSLAYRNSSNIPNGATNHVRQQKWQ
YTRSGHRKMADGEAVISTVNNVEEVHGQLFEVAPRYVNLSYIGEGAYGMVASALDTITRD
RVAIKKISPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLME
TDLYKLLKTQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFG
LARVTDPQTDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFP
GKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPGADPRALDL
LDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVCEEPFTLEMEFDDLPKEKLKELIWE
EAEAHHRRMEAEAAARNNGGQNPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgtggatacctaacaatttgtgcgcacagccgacaacgagaaatgctaaacca
ccatcgaacgggcatccacaagcgacacaacaacaatctgctccgggatcattggcatac
cgtaattcgagcaacataccgaatggagcaaccaaccacgtcagacaacagaaatggcag
tacactcgttcaggacatagaaagatggccgacggagaagcggttatctcgacggtcaac
aatgtcgaggaagttcatgggcaactttttgaggttgctccccgttatgtgaatctttca
tatattggagaaggtgcttacgggatggtcgcctctgcacttgacacaattactcgtgat
cgcgttgctatcaaaaagatttctccattcgaacatcagacattctgtcaacggacactt
cgggaaatcaaaattcttaatcgattcaagcatgagaatatcatcaatattcaagaaatc
atccgttcggagactgtcgatagtttgaaggatatttacatagttcaatgcctgatggag
actgatttgtacaaattgctgaaaactcaaaagctctcaaatgatcacgtttgctacttt
ctctatcaaattctccgtggtctcaaatacattcactctgcaaatgtgctccatcgtgat
ttgaaaccatcgaatttgttgctcaacaccacatgtgatctcaaaatttgcgattttgga
ttggcacgtgtcaccgacccacaaaccgatcatactgggttcttgaccgagtatgtggct
actcgttggtatagagctccagagattatgctcaattcaaagggatacactaaatcgatt
gatgtctggtctgtcggatgtattctcgcagaaatgctcagtaatcggccattgttcccg
ggaaaacattatttggatcaactcaatttgattttggcagttgttggatccccgtcaaat
gctgatttacaatgtattattaatgataaggctcgatcatatctcatttcattgccacac
aaaccaaaacaaccatgggctcggctctatccaggagctgatccaagagctcttgattta
ttggacaaaatgctcactttcaatccacataatcgtatcgacatcgagcaagcattggct
cacccatacttggagcaatactacgatccaggagatgagccagtttgtgaggaaccattc
actttggaaatggaattcgacgatttaccgaaggagaagctgaaggagctgatttgggaa
gaagccgaggctcatcacagacgaatggaggcagaagcggctgcaaggaataatggaggg
cagaatcctgtttag

DBGET integrated database retrieval system