KEGG   Caenorhabditis elegans (nematode): CELE_F43C1.2Help
Entry
CELE_F43C1.2      CDS       T00019                                 

Gene name
mpk-1
Definition
(RefSeq) Mitogen-activated protein kinase mpk-1
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_F43C1.2 (mpk-1)
   04012 ErbB signaling pathway
    CELE_F43C1.2 (mpk-1)
   04350 TGF-beta signaling pathway
    CELE_F43C1.2 (mpk-1)
   04068 FoxO signaling pathway
    CELE_F43C1.2 (mpk-1)
   04150 mTOR signaling pathway
    CELE_F43C1.2 (mpk-1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    CELE_F43C1.2 (mpk-1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    CELE_F43C1.2 (mpk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_F43C1.2 (mpk-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CELE_F43C1.2 (mpk-1)
Chromosome [BR:cel03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     CELE_F43C1.2 (mpk-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_F43C1.2 (mpk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
III:complement(join(4217396..4217615,4218081..4218680,4219078..4219133,4219188..4219314,4219465..4219523,4219575..4219643,4227891..4228094))
Genome map
AA seq 444 aa AA seqDB search
MPTWIPNNLCAQPTTRNAKPPSNGHPQATQQQSAPGSLAYRNSSNIPNGATNHVRQQKWQ
YTRSGHRKMADGEAVISTVNNVEEVHGQLFEVAPRYVNLSYIGEGAYGMVASALDTITRD
RVAIKKISPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLME
TDLYKLLKTQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFG
LARVTDPQTDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFP
GKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPGADPRALDL
LDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVCEEPFTLEMEFDDLPKEKLKELIWE
EAEAHHRRMEAEAAARNNGGQNPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgtggatacctaacaatttgtgcgcacagccgacaacgagaaatgctaaacca
ccatcgaacgggcatccacaagcgacacaacaacaatctgctccgggatcattggcatac
cgtaattcgagcaacataccgaatggagcaaccaaccacgtcagacaacagaaatggcag
tacactcgttcaggacatagaaagatggccgacggagaagcggttatctcgacggtcaac
aatgtcgaggaagttcatgggcaactttttgaggttgctccccgttatgtgaatctttca
tatattggagaaggtgcttacgggatggtcgcctctgcacttgacacaattactcgtgat
cgcgttgctatcaaaaagatttctccattcgaacatcagacattctgtcaacggacactt
cgggaaatcaaaattcttaatcgattcaagcatgagaatatcatcaatattcaagaaatc
atccgttcggagactgtcgatagtttgaaggatatttacatagttcaatgcctgatggag
actgatttgtacaaattgctgaaaactcaaaagctctcaaatgatcacgtttgctacttt
ctctatcaaattctccgtggtctcaaatacattcactctgcaaatgtgctccatcgtgat
ttgaaaccatcgaatttgttgctcaacaccacatgtgatctcaaaatttgcgattttgga
ttggcacgtgtcaccgacccacaaaccgatcatactgggttcttgaccgagtatgtggct
actcgttggtatagagctccagagattatgctcaattcaaagggatacactaaatcgatt
gatgtctggtctgtcggatgtattctcgcagaaatgctcagtaatcggccattgttcccg
ggaaaacattatttggatcaactcaatttgattttggcagttgttggatccccgtcaaat
gctgatttacaatgtattattaatgataaggctcgatcatatctcatttcattgccacac
aaaccaaaacaaccatgggctcggctctatccaggagctgatccaagagctcttgattta
ttggacaaaatgctcactttcaatccacataatcgtatcgacatcgagcaagcattggct
cacccatacttggagcaatactacgatccaggagatgagccagtttgtgaggaaccattc
actttggaaatggaattcgacgatttaccgaaggagaagctgaaggagctgatttgggaa
gaagccgaggctcatcacagacgaatggaggcagaagcggctgcaaggaataatggaggg
cagaatcctgtttag

DBGET integrated database retrieval system