KEGG   Caenorhabditis elegans (nematode): CELE_F45F2.12Help
Entry
CELE_F45F2.12     CDS       T00019                                 

Gene name
his-8
Definition
(RefSeq) Histone H2B 2
  KO
K11252  histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Chromosome [BR:cel03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CELE_F45F2.12 (his-8)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_F45F2.12 (his-8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W Endonuc-HincII DUF1931
Motif
Other DBs
NCBI-GeneID: 191670
NCBI-ProteinID: NP_505197
WormBase: WBGene00001882
Ensembl: WBGene00001878 WBGene00001894 WBGene00001896
UniProt: Q27894
Position
V:complement(8532715..8533086)
Genome map
AA seq 123 aa AA seqDB search
MAPPKPSAKGAKKAAKTVTKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIM
NSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggccccaccaaagccgtctgctaaaggagcaaagaaagccgccaagaccgtcaccaag
ccaaaggacggaaagaagagacgtcatgcccgtaaagaatcctactccgtgtacatctac
cgtgtgctcaagcaggttcatccagacactggagtctcttccaaggctatgtccatcatg
aactctttcgtcaacgacgtcttcgagcgtatcgctgctgaagcatctcgtcttgctcac
tacaacaagagatccaccatctcttctcgcgaaattcaaactgccgtccgtttgattctt
ccaggagagcttgccaagcacgccgtctccgagggaaccaaggctgtcaccaagtacacc
tctagcaagtaa

DBGET integrated database retrieval system