KEGG   Caenorhabditis elegans (nematode): CELE_F45F2.2Help
Entry
CELE_F45F2.2      CDS       T00019                                 

Gene name
his-39
Definition
Protein HIS-39
Orthology
K11252  
histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(8536292..8536312,8536389..8536694)
Genome map
AA seq 108 aa AA seqDB search
MNCCKIFKYLTPNFLHKESYSLYIFRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEA
SRLAHYNKRSTISSREIQTAVRLILPGELAKNAVSEGTNAVTKYTSSK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaattgttgcaaaatctttaaatatttgacccctaactttttacataaagaatcctac
tccttgtacatcttccgtgtgctcaagcaggttcatccagacactggagtctcttccaag
gctatgtccatcatgaactcgttcgtcaacgacgtcttcgagcgtatcgctgctgaggca
tctcgtcttgctcactacaacaagagatccaccatctcttctcgcgaaattcaaactgcc
gtccgtttgattcttccaggagagcttgccaagaacgccgtctctgagggaaccaatgct
gtcaccaagtacacctctagcaagtaa

DBGET integrated database retrieval system