KEGG   Caenorhabditis elegans (nematode): CELE_F45F2.2Help
Entry
CELE_F45F2.2      CDS       T00019                                 

Gene name
his-39
Definition
(RefSeq) HIStone
  KO
K11252  histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CELE_F45F2.2 (his-39)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_F45F2.2 (his-39)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 191681
NCBI-ProteinID: NP_505201
WormBase: WBGene00001913
Ensembl: WBGene00001913
UniProt: Q22979
Position
V:8536513..8536716
Genome map
AA seq 67 aa AA seqDB search
MSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKNAVSEGTNAV
TKYTSSK
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcatgaactcgttcgtcaacgacgtcttcgagcgtatcgctgctgaggcatct
cgtcttgctcactacaacaagagatccaccatctcttctcgcgaaattcaaactgccgtc
cgtttgattcttccaggagagcttgccaagaacgccgtctctgagggaaccaatgctgtc
accaagtacacctctagcaagtaa

DBGET integrated database retrieval system