KEGG   Caenorhabditis elegans (nematode): CELE_F46C5.3Help
Entry
CELE_F46C5.3      CDS       T00019                                 

Gene name
nas-25
Definition
Protein NAS-25
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_F46C5.3 (nas-25)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_F46C5.3 (nas-25)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(8826110..8826154,8826397..8826459,8826584..8826665,8826716..8826805,8826973..8827076,8827123..8827227,8827271..8827368,8827414..8827657,8827706..8827959,8828006..8828120)
Genome map
AA seq 399 aa AA seqDB search
MQIYLGITICLVAFLTVIDCAIPYYRTHSNFGSLGRRKVRQVQRDLTYRWPNNTVPYYVG
NVTSTIKKSVRLAIEELQAWTCIRFQNVNEKYSDGDSVRIVDLGSCSSPIGRQQIGTQDV
SLTKNCWGMGTAIHELMHAIGIEHTQSRSDRNRYLDILAQNIDNRDLPNFELLSPRLWAN
LVPYDYGSVMHYSADSFSNKDDEQTMLPKDRSFIETMGSMIPNFYDFDQINQYYQCYDSC
RNAGQLANCANGGIPNPNNCQVCNCPMGYGGDLCDQRPEGCGSTLVATDRWQKQKLSVRF
SRNDDQYFTFCNSWIVGPSDRTLQVIYEITSDSIRRQICSFGCYEGGIEVKHLQDPRITN
DRDCCLNTPLNLTTTVNPLPVILYTSGATVTYDFSYRYV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctatttaggtatcacaatttgtctcgtggcttttttgacggtcatcgactgt
gccattccgtattaccgcacacattcaaactttggatcactgggcaggagaaaagttaga
caagtccagagagatctcacatatagatggccaaacaatacggttccatattatgtggga
aatgtgacaagtacaatcaagaaatctgtgagattagctattgaggagcttcaggcatgg
acttgtattcggtttcaaaacgttaatgagaaatattcagatggagattcggtccgaata
gttgatcttggatcatgctcatctccgattggacgccaacaaattggaactcaagatgtc
tccttgactaagaattgttggggaatgggaactgcaattcacgaattaatgcatgcaatt
gggatcgagcatactcaatccagaagtgacaggaatcgatatttagatattctagctcaa
aacattgataatcgggatcttccgaatttcgaactactatcgcctcgtctctgggctaac
ctagtaccgtatgattatggaagtgttatgcattattcagctgattctttttcgaacaaa
gatgacgaacaaacaatgcttccaaaagatcgatcatttatcgaaacaatgggaagtatg
attccaaacttttacgacttcgatcaaattaatcagtattatcagtgttatgactcatgc
agaaatgccgggcaattagctaattgtgcaaatgggggaataccaaaccccaataattgt
caagtttgtaactgtccaatgggttatggtggagatctctgtgatcagaggccagaagga
tgtggcagtacactcgttgcaacagatcgctggcaaaaacagaagctttctgtgagattc
agtagaaatgatgatcagtatttcacgttttgtaattcatggattgtcggaccctccgat
cgaacattgcaagttatttatgaaattacatccgattcaatcagacgacaaatttgttca
tttggttgttatgaaggaggaattgaagtgaaacatcttcaggacccaaggataacaaat
gatagagattgttgtctgaatactccattaaatctaacaactactgttaatccactccca
gttattctatatacgtcgggagcaactgtcacttatgacttttcgtacagatacgtgtga

DBGET integrated database retrieval system