KEGG   Caenorhabditis elegans (nematode): CELE_F46C5.3Help
Entry
CELE_F46C5.3      CDS       T00019                                 

Gene name
nas-25
Definition
Protein NAS-25
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(8826051..8826095,8826338..8826400,8826525..8826606,8826657..8826746,8826914..8827017,8827064..8827168,8827212..8827309,8827355..8827598,8827647..8827900,8827947..8828061)
Genome map
AA seq 399 aa AA seqDB search
MQIYLGITICLVAFLTVIDCAIPYYRTHSNFGSLGRRKVRQVQRDLTYRWPNNTVPYYVG
NVTSTIKKSVRLAIEELQAWTCIRFQNVNEKYSDGDSVRIVDLGSCSSPIGRQQIGTQDV
SLTKNCWGMGTAIHELMHAIGIEHTQSRSDRNRYLDILAQNIDNRDLPNFELLSPRLWAN
LVPYDYGSVMHYSADSFSNKDDEQTMLPKDRSFIETMGSMIPNFYDFDQINQYYQCYDSC
RNAGQLANCANGGIPNPNNCQVCNCPMGYGGDLCDQRPEGCGSTLVATDRWQKQKLSVRF
SRNDDQYFTFCNSWIVGPSDRTLQVIYEITSDSIRRQICSFGCYEGGIEVKHLQDPRITN
DRDCCLNTPLNLTTTVNPLPVILYTSGATVTYDFSYRYV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctatttaggtatcacaatttgtctcgtggcttttttgacggtcatcgactgt
gccattccgtattaccgcacacattcaaactttggatcactgggcaggagaaaagttaga
caagtccagagagatctcacatatagatggccaaacaatacggttccatattatgtggga
aatgtgacaagtacaatcaagaaatctgtgagattagctattgaggagcttcaggcatgg
acttgtattcggtttcaaaacgttaatgagaaatattcagatggagattcggtccgaata
gttgatcttggatcatgctcatctccgattggacgccaacaaattggaactcaagatgtc
tccttgactaagaattgttggggaatgggaactgcaattcacgaattaatgcatgcaatt
gggatcgagcatactcaatccagaagtgacaggaatcgatatttagatattctagctcaa
aacattgataatcgggatcttccgaatttcgaactactatcgcctcgtctctgggctaac
ctagtaccgtatgattatggaagtgttatgcattattcagctgattctttttcgaacaaa
gatgacgaacaaacaatgcttccaaaagatcgatcatttatcgaaacaatgggaagtatg
attccaaacttttacgacttcgatcaaattaatcagtattatcagtgttatgactcatgc
agaaatgccgggcaattagctaattgtgcaaatgggggaataccaaaccccaataattgt
caagtttgtaactgtccaatgggttatggtggagatctctgtgatcagaggccagaagga
tgtggcagtacactcgttgcaacagatcgctggcaaaaacagaagctttctgtgagattc
agtagaaatgatgatcagtatttcacgttttgtaattcatggattgtcggaccctccgat
cgaacattgcaagttatttatgaaattacatccgattcaatcagacgacaaatttgttca
tttggttgttatgaaggaggaattgaagtgaaacatcttcaggacccaaggataacaaat
gatagagattgttgtctgaatactccattaaatctaacaactactgttaatccactccca
gttattctatatacgtcgggagcaactgtcacttatgacttttcgtacagatacgtgtga

DBGET integrated database retrieval system