KEGG   Caenorhabditis elegans (nematode): CELE_F46E10.8Help
Entry
CELE_F46E10.8     CDS       T00019                                 

Gene name
ubh-1
Definition
Protein UBH-1
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_F46E10.8 (ubh-1)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CELE_F46E10.8 (ubh-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(6510030..6510169,6510216..6510335,6510381..6510458,6510904..6510976,6511026..6511097,6511151..6511267,6511338..6511388))
Genome map
AA seq 216 aa AA seqDB search
MAAPWTPLESNPSVINPMIEKMGVSGVKTVDVLFFDDESIGKPQHAVILCFPEYKKVDEI
MKPIYEQAKAADDSVFFMKQKISNACGTFALFHSLANLEDRINLGDGSFAKWLAEAKKVG
IEERSDFLANNAELAGIHAAAATDGQTAPSGDVEHHFICFVGKNGILYEIDSRRPFAREI
GPTSDATLVKDAGAACQHLIEKLDNVSFSAIAVVNQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggccgctccatggactccgctcgaatcgaatccaagtgtcatcaatccgatgatcgaa
aaaatgggagtgagtggcgtgaagactgtcgatgtgttgttctttgatgacgagtcaatc
ggaaaacctcagcacgcagttatcctatgcttcccggaatacaaaaaggttgacgagatt
atgaagccgatctacgagcaagcgaaagcagctgacgattcggtgttttttatgaaacag
aaaatctcgaatgcttgtggaacattcgctctcttccattccctcgctaatcttgaagat
cgtattaatctaggggacggctcgtttgcgaaatggctggccgaggcgaaaaaggttgga
attgaggaacgttcggattttctagctaataatgctgagctagctggaatccatgctgcc
gcagcaaccgatgggcagacagcaccttcaggagacgttgagcatcatttcatttgtttc
gtcggaaagaatggaattctctacgagatcgattctcgccgcccgttcgctcgtgaaatc
ggtccaacttctgatgcaactctcgtcaaggacgccggagctgcgtgccaacatctcatt
gagaaactcgacaacgtcagcttctcggcaattgcagttgtcaatcaataa

DBGET integrated database retrieval system