KEGG   Caenorhabditis elegans (nematode): CELE_F46E10.8Help
Entry
CELE_F46E10.8     CDS       T00019                                 

Gene name
ubh-1
Definition
Protein UBH-1
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(6510013..6510152,6510199..6510318,6510364..6510441,6510887..6510959,6511009..6511080,6511134..6511250,6511321..6511371))
Genome map
AA seq 216 aa AA seqDB search
MAAPWTPLESNPSVINPMIEKMGVSGVKTVDVLFFDDESIGKPQHAVILCFPEYKKVDEI
MKPIYEQAKAADDSVFFMKQKISNACGTFALFHSLANLEDRINLGDGSFAKWLAEAKKVG
IEERSDFLANNAELAGIHAAAATDGQTAPSGDVEHHFICFVGKNGILYEIDSRRPFAREI
GPTSDATLVKDAGAACQHLIEKLDNVSFSAIAVVNQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggccgctccatggactccgctcgaatcgaatccaagtgtcatcaatccgatgatcgaa
aaaatgggagtgagtggcgtgaagactgtcgatgtgttgttctttgatgacgagtcaatc
ggaaaacctcagcacgcagttatcctatgcttcccggaatacaaaaaggttgacgagatt
atgaagccgatctacgagcaagcgaaagcagctgacgattcggtgttttttatgaaacag
aaaatctcgaatgcttgtggaacattcgctctcttccattccctcgctaatcttgaagat
cgtattaatctaggggacggctcgtttgcgaaatggctggccgaggcgaaaaaggttgga
attgaggaacgttcggattttctagctaataatgctgagctagctggaatccatgctgcc
gcagcaaccgatgggcagacagcaccttcaggagacgttgagcatcatttcatttgtttc
gtcggaaagaatggaattctctacgagatcgattctcgccgcccgttcgctcgtgaaatc
ggtccaacttctgatgcaactctcgtcaaggacgccggagctgcgtgccaacatctcatt
gagaaactcgacaacgtcagcttctcggcaattgcagttgtcaatcaataa

DBGET integrated database retrieval system