KEGG   Caenorhabditis elegans (nematode): CELE_F47F2.1Help
Entry
CELE_F47F2.1      CDS       T00019                                 

Gene name
F47F2.1
Definition
(RefSeq) cAMP-dependent protein kinase, catalytic subunit-like
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CELE_F47F2.1 (F47F2.1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   CELE_F47F2.1 (F47F2.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
X:join(3884262..3884342,3888487..3888603,3888653..3888743,3891077..3891245,3891304..3891393,3891487..3891565,3891616..3891710,3892467..3892682,3892732..3892867,3892918..3893040)
Genome map
AA seq 398 aa AA seqDB search
MVILSHHKRSPPLLMRLFRICRFFRRLMSSSTSSVESVEDESCSNECSASFTFDTNNNSR
GNNQVNELAEETHMKLSITPTRESFSLSQLERIITIGKGTFGRVELARDKITGAHYALKV
LNIRRVVDMRQTQHVHNEKRVLLQLKHPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLR
ASRSFSNSMARFYASEIVCALEYIHSLGIVYRDLKPENLMLSKEGHIKMADFGFAKELRD
RTYTICGTPDYLAPESLARTGHNKGVDWWALGILIYEMMVGKPPFRGKTTSEIYDAIIEH
KLKFPRSFNLAAKDLVKKLLEVDRTQRIGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPP
IVPTLYHPGDTGNFDDYEEDTTGGPLCSQRDRDLFAEW
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggttattctgagtcatcataaacgatcaccgccacttttaatgaggcttttccgcatt
tgtcgttttttccgacgtttgatgtcttcgtcgacatcatcagtggaatcagtggaagat
gaaagttgttcaaacgagtgttcagcctcattcaccttcgacaccaacaacaatagtcga
gggaacaaccaggtgaacgagcttgccgaggaaactcacatgaaactcagcatcacacca
acccgcgaatccttctcgctgagccagttggagcgtattataacgattggaaaaggaaca
ttcgggcgggttgagctggctcgggacaaaatcaccggagcacattatgcactgaaagtg
ctcaacattcggcgtgtcgtcgacatgcgtcaaactcaacatgttcataatgaaaaacgg
gttcttcttcagttaaaacatccgtttattgtaaaaatgtatgccagtgaaaaagatagt
aatcatttgtacatgatcatggaatttgtgccaggaggtgaaatgttctcttatctcaga
gcatcacgatcattctcgaattcgatggctcgtttttatgcatcagaaattgtttgtgct
ctggaatacattcactcattgggaattgtgtatcgagatttaaagccagagaatctcatg
ctcagcaaagaagggcatatcaaaatggctgatttcggatttgcaaaagaacttagagat
cgaacatacacgatttgtggaactccagattatctggctccggaatcactggccaggaca
ggccacaacaaaggtgttgattggtgggctctaggcattcttatctacgagatgatggtc
ggaaagcccccattccgtggaaagacgacatcagaaatctatgatgctatcattgagcac
aagctcaagttcccaagaagctttaatcttgccgcaaaagatctcgttaaaaaattactg
gaagtagatagaactcaacgcatcggatgtatgaagaatggtactcaagatgtgaaagac
cataaatggtttgagaaagtcaactgggatgatacgcttcatctccgtgttgagcctcca
attgtacctacattgtatcatccaggagatacgggaaacttcgatgactatgaagaagac
actaccggtggaccattgtgtagtcaacgtgatcgcgatcttttcgccgaatggtga

DBGET integrated database retrieval system