KEGG   Caenorhabditis elegans (nematode): CELE_F47F2.1Help
Entry
CELE_F47F2.1      CDS       T00019                                 

Gene name
F47F2.1
Definition
Protein F47F2.1, isoform B
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cel04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cel04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:cel04340]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cel04020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(3884243..3884323,3888468..3888584,3888634..3888724,3891058..3891226,3891285..3891374,3891468..3891546,3891597..3891691,3892448..3892663,3892713..3892848,3892899..3893021)
Genome map
AA seq 398 aa AA seqDB search
MVILSHHKRSPPLLMRLFRICRFFRRLMSSSTSSVESVEDESCSNECSASFTFDTNNNSR
GNNQVNELAEETHMKLSITPTRESFSLSQLERIITIGKGTFGRVELARDKITGAHYALKV
LNIRRVVDMRQTQHVHNEKRVLLQLKHPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLR
ASRSFSNSMARFYASEIVCALEYIHSLGIVYRDLKPENLMLSKEGHIKMADFGFAKELRD
RTYTICGTPDYLAPESLARTGHNKGVDWWALGILIYEMMVGKPPFRGKTTSEIYDAIIEH
KLKFPRSFNLAAKDLVKKLLEVDRTQRIGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPP
IVPTLYHPGDTGNFDDYEEDTTGGPLCSQRDRDLFAEW
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggttattctgagtcatcataaacgatcaccgccacttttaatgaggcttttccgcatt
tgtcgttttttccgacgtttgatgtcttcgtcgacatcatcagtggaatcagtggaagat
gaaagttgttcaaacgagtgttcagcctcattcaccttcgacaccaacaacaatagtcga
gggaacaaccaggtgaacgagcttgccgaggaaactcacatgaaactcagcatcacacca
acccgcgaatccttctcgctgagccagttggagcgtattataacgattggaaaaggaaca
ttcgggcgggttgagctggctcgggacaaaatcaccggagcacattatgcactgaaagtg
ctcaacattcggcgtgtcgtcgacatgcgtcaaactcaacatgttcataatgaaaaacgg
gttcttcttcagttaaaacatccgtttattgtaaaaatgtatgccagtgaaaaagatagt
aatcatttgtacatgatcatggaatttgtgccaggaggtgaaatgttctcttatctcaga
gcatcacgatcattctcgaattcgatggctcgtttttatgcatcagaaattgtttgtgct
ctggaatacattcactcattgggaattgtgtatcgagatttaaagccagagaatctcatg
ctcagcaaagaagggcatatcaaaatggctgatttcggatttgcaaaagaacttagagat
cgaacatacacgatttgtggaactccagattatctggctccggaatcactggccaggaca
ggccacaacaaaggtgttgattggtgggctctaggcattcttatctacgagatgatggtc
ggaaagcccccattccgtggaaagacgacatcagaaatctatgatgctatcattgagcac
aagctcaagttcccaagaagctttaatcttgccgcaaaagatctcgttaaaaaattactg
gaagtagatagaactcaacgcatcggatgtatgaagaatggtactcaagatgtgaaagac
cataaatggtttgagaaagtcaactgggatgatacgcttcatctccgtgttgagcctcca
attgtacctacattgtatcatccaggagatacgggaaacttcgatgactatgaagaagac
actaccggtggaccattgtgtagtcaacgtgatcgcgatcttttcgccgaatggtga

DBGET integrated database retrieval system