KEGG   Caenorhabditis elegans (nematode): CELE_F47F2.1Help
Entry
CELE_F47F2.1      CDS       T00019                                 

Gene name
F47F2.1
Definition
Protein F47F2.1, isoform A
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_F47F2.1 (F47F2.1)
   04310 Wnt signaling pathway
    CELE_F47F2.1 (F47F2.1)
   04340 Hedgehog signaling pathway
    CELE_F47F2.1 (F47F2.1)
   04020 Calcium signaling pathway
    CELE_F47F2.1 (F47F2.1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CELE_F47F2.1 (F47F2.1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CELE_F47F2.1 (F47F2.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(3891172..3891245,3891304..3891393,3891487..3891565,3891616..3891710,3892467..3892682,3892732..3892867,3892918..3893040)
Genome map
AA seq 270 aa AA seqDB search
MRQTQHVHNEKRVLLQLKHPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNS
MARFYASEIVCALEYIHSLGIVYRDLKPENLMLSKEGHIKMADFGFAKELRDRTYTICGT
PDYLAPESLARTGHNKGVDWWALGILIYEMMVGKPPFRGKTTSEIYDAIIEHKLKFPRSF
NLAAKDLVKKLLEVDRTQRIGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPPIVPTLYHP
GDTGNFDDYEEDTTGGPLCSQRDRDLFAEW
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaactcaacatgttcataatgaaaaacgggttcttcttcagttaaaacatccg
tttattgtaaaaatgtatgccagtgaaaaagatagtaatcatttgtacatgatcatggaa
tttgtgccaggaggtgaaatgttctcttatctcagagcatcacgatcattctcgaattcg
atggctcgtttttatgcatcagaaattgtttgtgctctggaatacattcactcattggga
attgtgtatcgagatttaaagccagagaatctcatgctcagcaaagaagggcatatcaaa
atggctgatttcggatttgcaaaagaacttagagatcgaacatacacgatttgtggaact
ccagattatctggctccggaatcactggccaggacaggccacaacaaaggtgttgattgg
tgggctctaggcattcttatctacgagatgatggtcggaaagcccccattccgtggaaag
acgacatcagaaatctatgatgctatcattgagcacaagctcaagttcccaagaagcttt
aatcttgccgcaaaagatctcgttaaaaaattactggaagtagatagaactcaacgcatc
ggatgtatgaagaatggtactcaagatgtgaaagaccataaatggtttgagaaagtcaac
tgggatgatacgcttcatctccgtgttgagcctccaattgtacctacattgtatcatcca
ggagatacgggaaacttcgatgactatgaagaagacactaccggtggaccattgtgtagt
caacgtgatcgcgatcttttcgccgaatggtga

DBGET integrated database retrieval system