KEGG   Caenorhabditis elegans (nematode): CELE_F49E11.1Help
Entry
CELE_F49E11.1     CDS       T00019                                 

Gene name
mbk-2
Definition
Protein MBK-2, isoform D
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CELE_F49E11.1 (mbk-2)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CELE_F49E11.1 (mbk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(13031644..13031768,13032540..13032855,13032912..13033175,13033229..13033951)
Genome map
AA seq 475 aa AA seqDB search
MTQSIGGPNKHLSASHSTLNTASTHDMMHSKIPKSPSNESLSRSHTSSSGGSQGGHNSNS
GSNSGFRPEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENG
SYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIR
ILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKF
AYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFY
RAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLET
AKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELF
VDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLADHEVCFIIF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatcgatcggtggacccaataaacatttgtcagcgtcacactcaacactaaat
actgcatcaactcacgatatgatgcattcgaagattccaaagagcccgagcaatgagagt
ttaagccgatcacacacatcctcgtcgggaggcagtcaaggtggacacaattcgaattct
ggttcaaactctggtttccgaccggaagatgctgtacagacgtttggcgcgaagctggtg
ccgtttgagaaaaatgagatttacaactatacacgggtctttttcgtcggatcacacgct
aaaaagcaggccggtgtgattggtggtgcgaataatggtggatatgatgatgaaaatggg
tcctatcagcttgttgtacacgatcatattgcgtaccggtacgaggtgctcaaggttatc
ggaaaaggatcgtttggacaggtaatcaaggcattcgatcacaaatatcaacaatatgtg
gctctgaagcttgtaagaaatgagaagcgattccatcgtcaggctgacgaggagattcga
attcttgatcatttgcggcggcaggattccgatggaacacacaatattatccatatgctc
gactatttcaatttccgtaatcacaagtgcatcacgtttgagcttctcagcatcaacctt
tacgagttgatcaagaggaacaagttccaaggattctcactgatgctcgtgagaaaattc
gcttattctatgctcttgtgtctggatcttttacaaaagaacaggctgattcattgtgat
ttgaagccggaaaatgttctgttgaagcaacaaggacggagtggaataaaagtcatcgat
tttggttcatcttgcttcgacgatcaacgtatatacacatatattcagtccagattctac
agagctccagaagtgattcttgggacaaaatacggaatgccaatagacatgtggtcactt
ggatgtattcttgccgagcttctcaccggatatccattattgcctggagaggatgagaat
gaccagctggcacttatcattgaactactcggaatgccaccaccgaaaagtttagaaaca
gcgaaacgtgcgcgtactttcatcacatcgaaaggatatccacgttattgcacggccaca
tcgatgccagatggttcggtagttctcgccggagcacgatcgaagcgaggaaagatgcgt
ggaccaccggcttcgcggtcgtggtcgacagcgttgaagaacatgggtgacgagttattc
gtggatttcttgaagagatgtctcgattgggatccggagaccagaatgactccagctcaa
gctttgaaacacaagtggcttcgtcgcaggttacccaatccaccacgggatggactggag
tcgatgggaggacttgccgatcatgaggtttgttttattattttctag

DBGET integrated database retrieval system