KEGG   Caenorhabditis elegans (nematode): CELE_F49E11.1Help
Entry
CELE_F49E11.1     CDS       T00019                                 

Gene name
mbk-2
Definition
(RefSeq) MBK-2, isoform C
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CELE_F49E11.1 (mbk-2)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CELE_F49E11.1 (mbk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:join(13009158..13009229,13009460..13009515,13014614..13014824,13014899..13015115,13023834..13024054,13024465..13024618,13031594..13031768,13032540..13032855,13032912..13033175,13033229..13033930,13034824..13034826)
Genome map
AA seq 796 aa AA seqDB search
MAALASFTRNSRSYGQQPIDVTQQGQRDRSVMSLDAQGRSVSHECPTSTTLVRQLYLPQI
PQSASFAAAPTSFSGASSSSSNHHHPVYHSQNSLPPNLLGSSQNSASSNSLVQGHRNPAL
GSGNTLTRSYHQPSSTNSSTNNLYGPLGTISRDLKQSIRDISPPVINSSANPHLVNYVQT
SSFDNGSYEFPSGQAQQQRRLGGSQQHLAPLQQTASSLYSNPQSSSSQLLGQQQAVRPNY
AYQQSLPRQQHINSHQTQAFFGTVRGPTNSTNIVTPLRASKTMIDVLAPVRDTVAAQATG
LPNVGTSSSNGSSNSSSGVGSGGSGSLMTQSIGGPNKHLSASHSTLNTASTHDMMHSKIP
KSPSNESLSRSHTSSSGGSQGGHNSNSGSNSGFRPEDAVQTFGAKLVPFEKNEIYNYTRV
FFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFD
HKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITF
ELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGR
SGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPL
LPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGAR
SKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPN
PPRDGLESMGGLADHE
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcttgcctcgttcacacgtaacagtcgaagttacgggcaacaaccgattgat
gttacacaacagggtcagcgagatcgcagtgtaatgagtctggatgcacaaggaagatca
gtttcacatgagtgtcccacatcaacaactcttgttcggcaactctatctgccgcagatt
ccacaatcggcgtcgtttgccgccgcgccaacctccttctcgggagcatcatcgtccagc
tccaaccatcatcatccggtataccattcgcaaaactcgttgccaccaaatctgctcgga
agctcacagaactcggcaagcagcaacagtcttgtacagggacaccgtaacccggctctc
ggctccggaaacacgctcactcgaagctaccatcaaccgtcgtccacgaattcgtcgacc
aacaatctctatggaccactaggtacaatttctcgtgatttgaagcaatcaattcgagat
atttctcctccagttatcaactcgtctgcaaatccgcatctcgtcaactacgtgcagacg
tcatcgtttgacaacggatcatacgagtttccgagtggacaagctcaacagcaacggcgt
ctcggtggatcgcagcaacacttggctccgctccaacaaaccgcctcgtcactttactcg
aatccgcaatcgtcgagctcacaacttcttggtcagcagcaagccgttcgtccgaactac
gcttatcagcagtctctgccacgccaacaacacatcaatagtcaccagacccaagcgttt
tttggaacagtacgaggaccgacgaactcgacgaacattgtcacacctctacgcgcatca
aaaacgatgattgacgtgttagcacctgtaagggatacggtagctgcacaagcaaccgga
ctaccaaatgttggaaccagctcctcaaatggctcgtccaactcgtcatctggtgttgga
tcgggaggatctggaagtctgatgacgcaatcgatcggtggacccaataaacatttgtca
gcgtcacactcaacactaaatactgcatcaactcacgatatgatgcattcgaagattcca
aagagcccgagcaatgagagtttaagccgatcacacacatcctcgtcgggaggcagtcaa
ggtggacacaattcgaattctggttcaaactctggtttccgaccggaagatgctgtacag
acgtttggcgcgaagctggtgccgtttgagaaaaatgagatttacaactatacacgggtc
tttttcgtcggatcacacgctaaaaagcaggccggtgtgattggtggtgcgaataatggt
ggatatgatgatgaaaatgggtcctatcagcttgttgtacacgatcatattgcgtaccgg
tacgaggtgctcaaggttatcggaaaaggatcgtttggacaggtaatcaaggcattcgat
cacaaatatcaacaatatgtggctctgaagcttgtaagaaatgagaagcgattccatcgt
caggctgacgaggagattcgaattcttgatcatttgcggcggcaggattccgatggaaca
cacaatattatccatatgctcgactatttcaatttccgtaatcacaagtgcatcacgttt
gagcttctcagcatcaacctttacgagttgatcaagaggaacaagttccaaggattctca
ctgatgctcgtgagaaaattcgcttattctatgctcttgtgtctggatcttttacaaaag
aacaggctgattcattgtgatttgaagccggaaaatgttctgttgaagcaacaaggacgg
agtggaataaaagtcatcgattttggttcatcttgcttcgacgatcaacgtatatacaca
tatattcagtccagattctacagagctccagaagtgattcttgggacaaaatacggaatg
ccaatagacatgtggtcacttggatgtattcttgccgagcttctcaccggatatccatta
ttgcctggagaggatgagaatgaccagctggcacttatcattgaactactcggaatgcca
ccaccgaaaagtttagaaacagcgaaacgtgcgcgtactttcatcacatcgaaaggatat
ccacgttattgcacggccacatcgatgccagatggttcggtagttctcgccggagcacga
tcgaagcgaggaaagatgcgtggaccaccggcttcgcggtcgtggtcgacagcgttgaag
aacatgggtgacgagttattcgtggatttcttgaagagatgtctcgattgggatccggag
accagaatgactccagctcaagctttgaaacacaagtggcttcgtcgcaggttacccaat
ccaccacgggatggactggagtcgatgggaggacttgccgatcatgagtga

DBGET integrated database retrieval system