KEGG   Caenorhabditis elegans (nematode): CELE_F52C9.7Help
Entry
CELE_F52C9.7      CDS       T00019                                 

Gene name
mog-3
Definition
Protein MOG-3
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CELE_F52C9.7 (mog-3)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   CELE_F52C9.7 (mog-3)
Spliceosome [BR:cel03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CELE_F52C9.7 (mog-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(5308602..5308765,5308826..5309239,5309285..5309350,5309400..5309495,5309541..5309757,5310462..5310745,5310963..5311077)
Genome map
AA seq 451 aa AA seqDB search
MSKDVSIGWMYEGAKGNVHREDYLLGKKVDKNFEKYSDVVNAQKAEAIDSIVGTRAVFNS
GQSTGLKTSSLQKDIIKSEDPFVAVKVREETKRREIMDNPLTKMRLQAALKSMMTSKAEK
SKEKKSKKDKKKKKKKRSSSSSDESSDERVERKRRRSPSPKRRRRPSEKPRKRSRSPRRE
RPRSPKRSREESRKLSRKPSSSRSKSPRRSREDPRKVARKPSRSRSRSAERLRRKSRSPR
RSREEPRKMSRSRSRSADKASSSRQFDSHIPRHLQQQRSRHDSSSGSESEHETRSSHRRR
NSDDDERQDPRKKSYGLVEMRKRTAEEREEESRAPTKEYKLVKIPTGRGTGNTPREPRRA
LSEAEKAARLAEMQQDNVKWRDEIRERNVTKGRKEDDEEKEEADKNGYAPSFIRSQMREA
CDDMTVEKRLQSNKRGVQRAHGYMDRSFAKK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagatgtatcaatcgggtggatgtatgaaggcgctaaaggaaatgtacaccga
gaagactatttactcggaaagaaagttgacaagaactttgaaaagtattccgatgtggtg
aatgcgcagaaagcagaagcaatcgattcgattgttgggacaagggctgtcttcaattcc
ggacaatcaacgggtttaaaaacttcttcacttcagaaagatattatcaaatccgaagat
ccatttgtcgccgtcaaggttcgagaagaaacaaaacgtcgggaaatcatggataatcct
ctcacaaaaatgcgacttcaagccgcgctgaaaagtatgatgacctcaaaagcagagaaa
agtaaagagaaaaagagtaaaaaagacaaaaagaagaaaaaaaagaagcgatcgtcgagt
tccagtgatgaaagcagtgatgaacgggtagaaagaaaaagaagacgctcgccatcgccg
aaacgaagaagaagacccagcgagaagcccagaaagcgttctagatcgcccagaagagaa
agaccaagatctccaaagcgatcccgtgaagagtccagaaaattgtcccggaaaccttcc
agttctcgatcgaaatctccaagacgatcccgagaggatcccagaaaagttgccagaaag
ccatccagatctcgatcaagatccgcagagcgactccgccggaaatccaggtctccgagg
cgatccagagaggaaccaagaaaaatgtccagatcccgctccagatctgccgacaaagcg
agctcttcaagacagtttgattctcacattccacgtcacctgcagcagcaacgaagtcgt
catgattcgagctcaggctcagaatctgagcacgaaactcggagcagtcaccgccgccgg
aatagtgatgatgacgagcgacaggatccgagaaagaagtcatatggcttggttgagatg
cgaaagcgaacagccgaggaacgtgaagaagagtcacgggcgcccaccaaggagtacaag
cttgtcaagattcccacaggacgtggtaccggcaatacgccaagagagccgcgacgagca
ttgagtgaagcagagaaggcggctcggctcgccgaaatgcagcaggacaacgtgaaatgg
agggacgagattcgcgagagaaatgtcacaaaaggacggaaagaggatgatgaggagaag
gaagaggcggataaaaatggatatgctccatcttttattagatctcaaatgcgcgaagcc
tgtgacgatatgacagtggagaagcgtctacaaagtaataaacgcggtgttcaacgagca
cacgggtatatggatcggagttttgcgaagaaatga

DBGET integrated database retrieval system