KEGG   Caenorhabditis elegans (nematode): CELE_F52C9.7Help
Entry
CELE_F52C9.7      CDS       T00019                                 

Gene name
F52C9.7
Definition
Protein F52C9.7
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(5308563..5308726,5308787..5309200,5309246..5309311,5309361..5309456,5309502..5309718,5310423..5310706,5310924..5311038)
Genome map
AA seq 451 aa AA seqDB search
MSKDVSIGWMYEGAKGNVHREDYLLGKKVDKNFEKYSDVVNAQKAEAIDSIVGTRAVFNS
GQSTGLKTSSLQKDIIKSEDPFVAVKVREETKRREIMDNPLTKMRLQAALKSMMTSKAEK
SKEKKSKKDKKKKKKKRSSSSSDESSDERVERKRRRSPSPKRRRRPSEKPRKRSRSPRRE
RPRSPKRSREESRKLSRKPSSSRSKSPRRSREDPRKVARKPSRSRSRSAERLRRKSRSPR
RSREEPRKMSRSRSRSADKASSSRQFDSHIPRHLQQQRSRHDSSSGSESEHETRSSHRRR
NSDDDERQDPRKKSYGLVEMRKRTAEEREEESRAPTKEYKLVKIPTGRGTGNTPREPRRA
LSEAEKAARLAEMQQDNVKWRDEIRERNVTKGRKEDDEEKEEADKNGYAPSFIRSQMREA
CDDMTVEKRLQSNKRGVQRAHGYMDRSFAKK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagatgtatcaatcgggtggatgtatgaaggcgctaaaggaaatgtacaccga
gaagactatttactcggaaagaaagttgacaagaactttgaaaagtattccgatgtggtg
aatgcgcagaaagcagaagcaatcgattcgattgttgggacaagggctgtcttcaattcc
ggacaatcaacgggtttaaaaacttcttcacttcagaaagatattatcaaatccgaagat
ccatttgtcgccgtcaaggttcgagaagaaacaaaacgtcgggaaatcatggataatcct
ctcacaaaaatgcgacttcaagccgcgctgaaaagtatgatgacctcaaaagcagagaaa
agtaaagagaaaaagagtaaaaaagacaaaaagaagaaaaaaaagaagcgatcgtcgagt
tccagtgatgaaagcagtgatgaacgggtagaaagaaaaagaagacgctcgccatcgccg
aaacgaagaagaagacccagcgagaagcccagaaagcgttctagatcgcccagaagagaa
agaccaagatctccaaagcgatcccgtgaagagtccagaaaattgtcccggaaaccttcc
agttctcgatcgaaatctccaagacgatcccgagaggatcccagaaaagttgccagaaag
ccatccagatctcgatcaagatccgcagagcgactccgccggaaatccaggtctccgagg
cgatccagagaggaaccaagaaaaatgtccagatcccgctccagatctgccgacaaagcg
agctcttcaagacagtttgattctcacattccacgtcacctgcagcagcaacgaagtcgt
catgattcgagctcaggctcagaatctgagcacgaaactcggagcagtcaccgccgccgg
aatagtgatgatgacgagcgacaggatccgagaaagaagtcatatggcttggttgagatg
cgaaagcgaacagccgaggaacgtgaagaagagtcacgggcgcccaccaaggagtacaag
cttgtcaagattcccacaggacgtggtaccggcaatacgccaagagagccgcgacgagca
ttgagtgaagcagagaaggcggctcggctcgccgaaatgcagcaggacaacgtgaaatgg
agggacgagattcgcgagagaaatgtcacaaaaggacggaaagaggatgatgaggagaag
gaagaggcggataaaaatggatatgctccatcttttattagatctcaaatgcgcgaagcc
tgtgacgatatgacagtggagaagcgtctacaaagtaataaacgcggtgttcaacgagca
cacgggtatatggatcggagttttgcgaagaaatga

DBGET integrated database retrieval system