KEGG   Caenorhabditis elegans (nematode): CELE_F52C9.7Help
Entry
CELE_F52C9.7      CDS       T00019                                 

Gene name
mog-3
Definition
(RefSeq) Masculinisation Of Germline
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
III:join(5308602..5308765,5308826..5309239,5309285..5309350,5309400..5309495,5309541..5309757,5310462..5310745,5310963..5311077)
Genome map
AA seq 451 aa AA seqDB search
MSKDVSIGWMYEGAKGNVHREDYLLGKKVDKNFEKYSDVVNAQKAEAIDSIVGTRAVFNS
GQSTGLKTSSLQKDIIKSEDPFVAVKVREETKRREIMDNPLTKMRLQAALKSMMTSKAEK
SKEKKSKKDKKKKKKKRSSSSSDESSDERVERKRRRSPSPKRRRRPSEKPRKRSRSPRRE
RPRSPKRSREESRKLSRKPSSSRSKSPRRSREDPRKVARKPSRSRSRSAERLRRKSRSPR
RSREEPRKMSRSRSRSADKASSSRQFDSHIPRHLQQQRSRHDSSSGSESEHETRSSHRRR
NSDDDERQDPRKKSYGLVEMRKRTAEEREEESRAPTKEYKLVKIPTGRGTGNTPREPRRA
LSEAEKAARLAEMQQDNVKWRDEIRERNVTKGRKEDDEEKEEADKNGYAPSFIRSQMREA
CDDMTVEKRLQSNKRGVQRAHGYMDRSFAKK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagatgtatcaatcgggtggatgtatgaaggcgctaaaggaaatgtacaccga
gaagactatttactcggaaagaaagttgacaagaactttgaaaagtattccgatgtggtg
aatgcgcagaaagcagaagcaatcgattcgattgttgggacaagggctgtcttcaattcc
ggacaatcaacgggtttaaaaacttcttcacttcagaaagatattatcaaatccgaagat
ccatttgtcgccgtcaaggttcgagaagaaacaaaacgtcgggaaatcatggataatcct
ctcacaaaaatgcgacttcaagccgcgctgaaaagtatgatgacctcaaaagcagagaaa
agtaaagagaaaaagagtaaaaaagacaaaaagaagaaaaaaaagaagcgatcgtcgagt
tccagtgatgaaagcagtgatgaacgggtagaaagaaaaagaagacgctcgccatcgccg
aaacgaagaagaagacccagcgagaagcccagaaagcgttctagatcgcccagaagagaa
agaccaagatctccaaagcgatcccgtgaagagtccagaaaattgtcccggaaaccttcc
agttctcgatcgaaatctccaagacgatcccgagaggatcccagaaaagttgccagaaag
ccatccagatctcgatcaagatccgcagagcgactccgccggaaatccaggtctccgagg
cgatccagagaggaaccaagaaaaatgtccagatcccgctccagatctgccgacaaagcg
agctcttcaagacagtttgattctcacattccacgtcacctgcagcagcaacgaagtcgt
catgattcgagctcaggctcagaatctgagcacgaaactcggagcagtcaccgccgccgg
aatagtgatgatgacgagcgacaggatccgagaaagaagtcatatggcttggttgagatg
cgaaagcgaacagccgaggaacgtgaagaagagtcacgggcgcccaccaaggagtacaag
cttgtcaagattcccacaggacgtggtaccggcaatacgccaagagagccgcgacgagca
ttgagtgaagcagagaaggcggctcggctcgccgaaatgcagcaggacaacgtgaaatgg
agggacgagattcgcgagagaaatgtcacaaaaggacggaaagaggatgatgaggagaag
gaagaggcggataaaaatggatatgctccatcttttattagatctcaaatgcgcgaagcc
tgtgacgatatgacagtggagaagcgtctacaaagtaataaacgcggtgttcaacgagca
cacgggtatatggatcggagttttgcgaagaaatga

DBGET integrated database retrieval system