KEGG   Caenorhabditis elegans (nematode): CELE_F55A8.2Help
Entry
CELE_F55A8.2      CDS       T00019                                 

Gene name
egl-4
Definition
(RefSeq) EGL-4, isoform H
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
cel  Caenorhabditis elegans (nematode)
Module
cGMP signaling
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     CELE_F55A8.2 (egl-4)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   CELE_F55A8.2 (egl-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:join(1848071..1848226,1860836..1861003,1862683..1862918,1864120..1864286,1865373..1865469,1871764..1871887,1873585..1873692,1875642..1876207,1877187..1877820,1879844..1879939)
Genome map
AA seq 783 aa AA seqDB search
MSSGSRPSSGGGGGGGGASGGAGGGAPGGGGGGIRGFFSKLRKPSDQPNGNQVQVGTRTF
EAHELQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQ
KAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQ
HYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFV
VAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQ
RLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKCLQGDAFF
VINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDR
ESFGKLIGDLESLKKDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGV
GGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTF
RDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPE
NCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYI
CELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGS
GGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWD
EGF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgggagccgtccgtcgagcggcggtggtggtggtggcggaggagccagtggt
ggagccggtggtggtgctccaggtggtggtggaggtggaatccgtggattcttctccaaa
cttcgtaagccgtctgatcagccgaatgggaatcaggtacaagtcggcacacgaacgttc
gaggctcacgagcttcagaagctgattccacagctcgaagaggcgatatctcggaaggat
gcacaactcagacagcaacagacaattgttgaaggacatattaagaggatttccgagttg
gagggagaggttaccacgcttcagagagaatgcgacaaattgcgttccgtactggaacaa
aaagctcaatcagctgccagccccggcggacaaccaccatcaccatctccacgtaccgat
caacttggcaatgatctacagcaaaaggccgtgctaccggccgacggagttcaacgagcc
aaaaagattgccgtttcagcagagccgacgaattttgagaataagccagccacacttcaa
cactataataagactgtcggagccaaacaaatgatacgtgacgccgtgcagaagaacgat
ttcctgaagcaattggcaaaggagcaaataattgagctcgtcaactgtatgtacgagatg
agagcacgcgccggacaatgggttatacaagaaggagaacctggagatcgacttttcgtc
gttgccgaaggagaattgcaagtttcacgtgagggagctcttcttggaaaaatgcgcgcc
gggaccgttatgggagagttggctattctctacaactgcacaagaaccgcatcagttcaa
gcattaaccgacgtacaattatgggtgctggatcgatccgtattccaaatgattacacag
agattgggaatggaacgtcactcgcagttgatgaatttcttgacaaaggtatcaatcttc
caaaatttgtcggaagatcgcatctcaaagatggccgacgtcatggatcaggactattat
gatggtggacattatatcattcgacagggtgaaaagtgtttacagggtgacgcattcttc
gtaatcaactcaggacaagtgaaagtcacccaacaaatcgaaggagaaaccgagccccga
gaaatccgtgtgctcaatcaaggagacttctttggagaacgtgcactgctcggcgaggag
gtccgtacagccaatattattgcacaagctccaggagttgaagtacttactttggatcga
gaatcattcggaaagcttatcggagatcttgaaagccttaaaaaagactatggagataag
gaacgtttggctcaagttgtccgagagccgccgagccctgtgaagattgtcgacgacttc
cgagaggagtttgcacaggttacactgaaaaatgtgaagaggctagcgacacttggagtt
ggaggatttggaagagttgaacttgtctgtgtaaatggagataaggcaaagacgtttgcg
ctgaaggctctgaagaagaagcatattgttgatacccggcaacaggagcacatctttgcc
gagcggaatattatgatggaaacttcaactgattggattgtcaagctttataagactttt
agagatcaaaagtttgtgtacatgctgctcgaggtatgccttggcggtgaactgtggacg
acactccgcgatcgaggacactttgacgattacaccgcccgtttctacgtggcctgcgtg
ctcgagggtctcgaatatctgcatcgcaagaatattgtctaccgagatttgaagcccgaa
aactgtctgctcgccaacactggatatctgaaacttgtggatttcggattcgcaaagaaa
ctcgcgtctggaaggaagacgtggacattctgtggaacaccggaatacgtgtcacctgaa
attattctcaataagggacacgatcaagccgccgactattgggctcttggaatatatatc
tgtgaactgatgctcggacggccaccgttccaggctagtgatcctatgaagacgtataca
ttgatcctaaagggagtagacgcactggagattccgaatcgtcggattggaaagacggcg
acggcgttggtgaagaagctctgcagggataacccgggagaacggctcggcagtggaagt
ggtggggtgaatgatattcggaagcatcggtggtttatgggattcgattgggaaggattg
agaagtaggacgttgaaacctccaattctgccgaaggtgtccaacccagcagacgtgacg
aatttcgacaattatccaccagataatgatgttccaccagacgagttttccggatgggat
gagggattctag

DBGET integrated database retrieval system