KEGG   Caenorhabditis elegans (nematode): CELE_F55A8.2Help
Entry
CELE_F55A8.2      CDS       T00019                                 

Gene name
pkg-1
Definition
Protein PKG-1, isoform A
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     CELE_F55A8.2 (pkg-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   CELE_F55A8.2 (pkg-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(1848070..1848225,1860835..1861002,1862682..1862917,1864119..1864285,1865373..1865469,1871764..1871887,1873585..1873692,1875651..1876207,1877187..1877820,1879844..1879939)
Genome map
AA seq 780 aa AA seqDB search
MSSGSRPSSGGGGGGGGASGGAGGGAPGGGGGGIRGFFSKLRKPSDQPNGNQVQVGTRTF
EAHELQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQ
KAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQ
HYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFV
VAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQ
RLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVIN
SGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESF
GKLIGDLESLKKDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGF
GRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQ
KFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCL
LANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICEL
MLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGV
NDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgggagccgtccgtcgagcggcggtggtggtggtggcggaggagccagtggt
ggagccggtggtggtgctccaggtggtggtggaggtggaatccgtggattcttctccaaa
cttcgtaagccgtctgatcagccgaatgggaatcaggtacaagtcggcacacgaacgttc
gaggctcacgagcttcagaagctgattccacagctcgaagaggcgatatctcggaaggat
gcacaactcagacagcaacagacaattgttgaaggacatattaagaggatttccgagttg
gagggagaggttaccacgcttcagagagaatgcgacaaattgcgttccgtactggaacaa
aaagctcaatcagctgccagccccggcggacaaccaccatcaccatctccacgtaccgat
caacttggcaatgatctacagcaaaaggccgtgctaccggccgacggagttcaacgagcc
aaaaagattgccgtttcagcagagccgacgaattttgagaataagccagccacacttcaa
cactataataagactgtcggagccaaacaaatgatacgtgacgccgtgcagaagaacgat
ttcctgaagcaattggcaaaggagcaaataattgagctcgtcaactgtatgtacgagatg
agagcacgcgccggacaatgggttatacaagaaggagaacctggagatcgacttttcgtc
gttgccgaaggagaattgcaagtttcacgtgagggagctcttcttggaaaaatgcgcgcc
gggaccgttatgggagagttggctattctctacaactgcacaagaaccgcatcagttcaa
gcattaaccgacgtacaattatgggtgctggatcgatccgtattccaaatgattacacag
agattgggaatggaacgtcactcgcagttgatgaatttcttgacaaaggtatcaatcttc
caaaatttgtcggaagatcgcatctcaaagatggccgacgtcatggatcaggactattat
gatggtggacattatatcattcgacagggtgaaaagggtgacgcattcttcgtaatcaac
tcaggacaagtgaaagtcacccaacaaatcgaaggagaaaccgagccccgagaaatccgt
gtgctcaatcaaggagacttctttggagaacgtgcactgctcggcgaggaggtccgtaca
gccaatattattgcacaagctccaggagttgaagtacttactttggatcgagaatcattc
ggaaagcttatcggagatcttgaaagccttaaaaaagactatggagataaggaacgtttg
gctcaagttgtccgagagccgccgagccctgtgaagattgtcgacgacttccgagaggag
tttgcacaggttacactgaaaaatgtgaagaggctagcgacacttggagttggaggattt
ggaagagttgaacttgtctgtgtaaatggagataaggcaaagacgtttgcgctgaaggct
ctgaagaagaagcatattgttgatacccggcaacaggagcacatctttgccgagcggaat
attatgatggaaacttcaactgattggattgtcaagctttataagacttttagagatcaa
aagtttgtgtacatgctgctcgaggtatgccttggcggtgaactgtggacgacactccgc
gatcgaggacactttgacgattacaccgcccgtttctacgtggcctgcgtgctcgagggt
ctcgaatatctgcatcgcaagaatattgtctaccgagatttgaagcccgaaaactgtctg
ctcgccaacactggatatctgaaacttgtggatttcggattcgcaaagaaactcgcgtct
ggaaggaagacgtggacattctgtggaacaccggaatacgtgtcacctgaaattattctc
aataagggacacgatcaagccgccgactattgggctcttggaatatatatctgtgaactg
atgctcggacggccaccgttccaggctagtgatcctatgaagacgtatacattgatccta
aagggagtagacgcactggagattccgaatcgtcggattggaaagacggcgacggcgttg
gtgaagaagctctgcagggataacccgggagaacggctcggcagtggaagtggtggggtg
aatgatattcggaagcatcggtggtttatgggattcgattgggaaggattgagaagtagg
acgttgaaacctccaattctgccgaaggtgtccaacccagcagacgtgacgaatttcgac
aattatccaccagataatgatgttccaccagacgagttttccggatgggatgagggattc
tag

DBGET integrated database retrieval system