KEGG   Caenorhabditis elegans (nematode): CELE_F56C9.1Help
Entry
CELE_F56C9.1      CDS       T00019                                 

Gene name
gsp-2
Definition
Protein GSP-2
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CELE_F56C9.1 (gsp-2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CELE_F56C9.1 (gsp-2)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CELE_F56C9.1 (gsp-2)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CELE_F56C9.1 (gsp-2)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     CELE_F56C9.1 (gsp-2)
Spliceosome [BR:cel03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CELE_F56C9.1 (gsp-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(7336623..7336674,7336731..7336862,7336989..7337219,7337278..7337492,7337542..7337655,7337703..7337837,7338067..7338189)
Genome map
AA seq 333 aa AA seqDB search
MDVEKLNLDNIISRLLEVRGSKPGKNVQLTESEIKGLCQKSREIFLSQPILLELEAPLKI
CGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPEVVAKFLHKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMTVDETLMCSFQILKPADK
KKYPYGAGGVGSNRPVTPPRNAPAAQPKKGAKK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggacgtagaaaagcttaatctggacaatatcatctccagattattggaagtcagagga
tccaaaccagggaaaaatgttcaactcacagagagcgagatcaaggggttgtgccagaag
tctcgtgaaatttttctgagccaacctattcttctcgagttggaagctccgttgaaaatt
tgcggtgacgtgcacggacaatactacgatcttttgagactgttcgagtatggtggattc
cccccagagtcgaactacttgttcctcggcgattatgtggaccgagggaaacaatcgttg
gaaactatctgtctcctacttgcatataaaatcaagtacccggaaaatttcttcctgctc
cgaggaaaccacgagtgtgcctcgatcaacagaatttatggcttctatgacgagtgcaag
cggcgatacaacatcaaactgtggaagacgttcaccgattgctttaactgcctgccagtt
gccgccatcatcgacgaaaagatcttctgctgtcacggaggactttctccagatcttcag
tctatggagcaaattcgtcgtatcatgaggccgacagacgtaccagatcaaggattgttg
tgcgatctgttgtggtcagatcctgataaagatgtcactggctggggagaaaacgaccga
ggcgtctctttcactttcggaccagaagttgttgccaaattcctgcacaagcacgatttg
gatttgatttgcagagctcaccaggttgtggaagacggttacgaattcttcgctaagcgg
cagttggttacattgttcagcgctcctaattattgtggagagtttgataacgcgggatcg
atgatgactgtcgatgaaacactgatgtgctctttccagatcttgaaaccagcagacaag
aagaaatatccatatggtgctggaggagttggttcaaatagaccagtcaccccaccacga
aacgcaccggctgcgcaaccaaagaagggtgccaagaagtaa

DBGET integrated database retrieval system