KEGG   Caenorhabditis elegans (nematode): CELE_F56C9.1Help
Entry
CELE_F56C9.1      CDS       T00019                                 

Gene name
gsp-2
Definition
Protein GSP-2
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:cel03015]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(7336559..7336610,7336667..7336798,7336925..7337155,7337214..7337428,7337478..7337591,7337639..7337773,7338003..7338125)
Genome map
AA seq 333 aa AA seqDB search
MDVEKLNLDNIISRLLEVRGSKPGKNVQLTESEIKGLCQKSREIFLSQPILLELEAPLKI
CGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPEVVAKFLHKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMTVDETLMCSFQILKPADK
KKYPYGAGGVGSNRPVTPPRNAPAAQPKKGAKK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggacgtagaaaagcttaatctggacaatatcatctccagattattggaagtcagagga
tccaaaccagggaaaaatgttcaactcacagagagcgagatcaaggggttgtgccagaag
tctcgtgaaatttttctgagccaacctattcttctcgagttggaagctccgttgaaaatt
tgcggtgacgtgcacggacaatactacgatcttttgagactgttcgagtatggtggattc
cccccagagtcgaactacttgttcctcggcgattatgtggaccgagggaaacaatcgttg
gaaactatctgtctcctacttgcatataaaatcaagtacccggaaaatttcttcctgctc
cgaggaaaccacgagtgtgcctcgatcaacagaatttatggcttctatgacgagtgcaag
cggcgatacaacatcaaactgtggaagacgttcaccgattgctttaactgcctgccagtt
gccgccatcatcgacgaaaagatcttctgctgtcacggaggactttctccagatcttcag
tctatggagcaaattcgtcgtatcatgaggccgacagacgtaccagatcaaggattgttg
tgcgatctgttgtggtcagatcctgataaagatgtcactggctggggagaaaacgaccga
ggcgtctctttcactttcggaccagaagttgttgccaaattcctgcacaagcacgatttg
gatttgatttgcagagctcaccaggttgtggaagacggttacgaattcttcgctaagcgg
cagttggttacattgttcagcgctcctaattattgtggagagtttgataacgcgggatcg
atgatgactgtcgatgaaacactgatgtgctctttccagatcttgaaaccagcagacaag
aagaaatatccatatggtgctggaggagttggttcaaatagaccagtcaccccaccacga
aacgcaccggctgcgcaaccaaagaagggtgccaagaagtaa

DBGET integrated database retrieval system