KEGG   Caenorhabditis elegans (nematode): CELE_F57C12.1Help
Entry
CELE_F57C12.1     CDS       T00019                                 

Gene name
nas-38
Definition
Protein NAS-38
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_F57C12.1 (nas-38)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_F57C12.1 (nas-38)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(558190..558335,558391..558469,558843..558959,559006..559103,559492..559621,559671..559772,559833..559941,559990..560120,560334..560487,560952..561019,561486..561579,561624..561874,562473..562706,562750..562844,562888..562961,563182..563287,563336..563449,563494..563629)
Genome map
AA seq 745 aa AA seqDB search
MPSPSYNRHIIIASCFCCLLIFSSAARVPKASKKHLARVKQLLNDEAERHNTLIQSDSVT
VFDDIQRNPNTGVHHDELAVNNADEYFQGDVDLSEQQVKIIEDQFTQGKREKRKIGRNPL
YKKWDTRGPISFDYAESIPFQTRQKIRSAMLLWQQHTCLRFEEGGPNVDRLEFFDGGGCS
SFVGRVGGTQGISISTPGCDVVGIISHEIGHALGIFHEQARPDQERHIAINYNNIPLSRW
NNFQAVGENHAETYNLPYDTGSVMHYGPYGFASDPYTPTIRTLERVQQSTIGQRAGPSFL
DYQAINMAYGCTESCADLPCLRNGYTHPNNCSMCACPEGLSGRYCEQVYPSNAQCARGKL
TRERHINERECYQSAIWTATKEVKYITSPNYPDKFPIDTECNWIIAAPIEGRVFMEFEGD
FDFLCEDTCDKAYVEVKYHSDKRLTGARYCCSLLPKNRFISFKNEMIIIMRGYRSSGAGF
KAKFWSNLGEPEGVSTPLPPTTAPLPEISETTQKPEPTTVQSTTTYTTAIPRRTAKKQFF
TRKPITIPLTPLTSSSTTTESTTVSSTTQSTTWLPTEPSFATGETEITTASPTITLFPSL
STILPPINSLAGVLPSTQAPDIINSVLECGCGAWSEWQGECSQQCGGCGHRLRKRECKKE
ACRKEEKRPCNFSACPDGTNFLINNAEFHILWRGCCVGLFRSGDQCSALETESNPFFKII
NSLLNIQDAKNNDTLIAKRMMRGEH
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtccttcttacaatcgtcacattattattgcctcatgtttttgttgtcttctt
attttttcatcagctgcgcgagttccgaaagcttcgaaaaaacatcttgccagggtgaag
cagctgctgaatgatgaagctgaaagacacaatacattaattcaaagcgattcagttact
gtctttgatgatatacaacgaaatccaaatacaggagtacatcacgatgaattggcagtg
aataacgctgacgagtatttccaaggagatgttgacttgtctgaacaacaagtgaaaatt
attgaagatcagtttacacagggcaaaagagaaaaaagaaagattggaagaaatccattg
tataaaaagtgggatacaagagggcctattagttttgattatgccgaaagtataccgttc
caaacaagacaaaaaatcagaagtgcaatgctcctatggcagcaacatacatgcctccga
tttgaagaaggaggtccaaatgtggatagactagagtttttcgatggaggaggatgttct
tcctttgttggaagagttggtggaacacagggaatttctatttcaactccaggatgtgat
gttgttgggattataagtcacgaaataggacacgcattaggtattttccacgaacaagct
cgaccggaccaggaacgacatatcgctatcaactacaacaatattccactctccagatgg
aataatttccaagctgttggagaaaatcacgcggaaacttataacctaccatatgacacc
ggaagcgtcatgcattatggtccgtacgggtttgcgtctgatccatatactccaactatt
cggacacttgaaagagttcagcagtcgacaattggtcaaagagctggcccatcgttttta
gattaccaagcaattaacatggcatatggatgcacagagtcgtgcgcagaccttccatgc
cttcgtaacggatacacccaccccaataactgctccatgtgcgcatgtcccgaaggttta
tcaggaagatattgtgaacaagtgtacccgtcaaacgctcaatgtgctcgtggaaaacta
acccgtgaacgtcatattaatgaacgtgaatgttaccaatcggccatttggacagctaca
aaggaagtgaagtacatcactagcccaaattaccctgacaaatttccaattgacaccgaa
tgcaattggattatcgcagcgccaatcgaaggaagagtgttcatggaatttgaaggagat
tttgattttctctgcgaagacacttgcgacaaggcatacgtagaagttaaatatcatagt
gacaaacgtcttactggagccagatactgttgctcgctgcttccaaaaaatcgattcatc
tctttcaaaaatgagatgattattataatgagagggtatagatcaagtggagctgggttt
aaagccaagttctggtctaatttgggagagccagaaggagttagcactccattgccgcca
acaacagctccgctcccagaaatttcggaaacaacacaaaagccagaaccaaccactgta
caatctacaactacatatacaacggcaattccgcggagaaccgcaaaaaaacagttcttc
acaagaaaacccatcacaatcccattgacacctctaacttcctcgtcaactacaacggag
tctaccactgtatcttctacgacacaatcaactacctggttgccaactgaaccatcattc
gctaccggcgaaacggaaatcacaactgcaagccccacaatcacgttattcccaagttta
tcaactatacttcctcctatcaattcgttagctggagttctaccatctacacaagctcca
gatattatcaatagtgtattagaatgcggctgtggagcttggtctgaatggcaaggtgaa
tgctcccagcagtgtggcggatgcggtcatcgactgaggaagcgagagtgcaaaaaagaa
gcttgcagaaaagaagaaaaacgcccatgcaacttctcagcatgccccgacggcactaac
ttcctaatcaacaatgctgaattccatattctttggagagggtgttgtgttgggttgttc
agatccggagatcaatgctccgccctggaaactgaatcgaacccattcttcaaaattatc
aacagcctgctgaacattcaagatgctaagaacaatgatacgttaatagcaaaaagaatg
atgcgaggagaacactaa

DBGET integrated database retrieval system