KEGG   Caenorhabditis elegans (nematode): CELE_F58A6.4Help
Entry
CELE_F58A6.4      CDS       T00019                                 

Gene name
nas-29
Definition
Protein NAS-29
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_F58A6.4 (nas-29)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_F58A6.4 (nas-29)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(5138696..5138820,5138864..5138976,5139362..5139483,5139534..5139608,5139660..5139817,5139876..5140003,5140050..5140123,5140263..5140394,5140444..5140545,5140593..5140684,5140829..5141049,5141178..5141245,5141295..5141390,5141717..5141809))
Genome map
AA seq 532 aa AA seqDB search
MISKNTSFCGFLILVLATCMSAQFVSNESIKLHDILKPSATHRLFDTLQYSVEEQYSDSH
LSFDVSTIYNYSEKPISIGKLNKKYRDILFEGDMAISYKQLSMIVNGSTEYRKAIKSRRR
GNKINGESTDRTKRQAYLDNNYPATIWKNGVAFMFHESLTPIAKTAILKAVHFWYRETCI
EFHPRTFQKEYLLFIGNDDGCWSTVGRDASQGKQVVSIGNGCEHFGVTSHELAHALGIFH
EQSRFDRDESVVFNPRVVERDLLFNFAKISPRQMSTYGLPYDIGSVMHYTPTEFSNIPSI
PTLAAIDTNLQQTMGQLEGPSFVDVHIMNQHYQCQEKCPTQAPCQNGGFTNSRNCKVCKC
PTGFGGAYCQLIASSFSPFCGGYLNAEETTRRFDITIRQSTTTRSKTCVYHIKAPEGKRI
IIDILKIDSKCIEGCWQDGLELKMKKDFRPVGYRFCCPESSRRKVISEGNMVPFMVFSKE
HDFSVSFEYSFVSTSAGFDDEKNDSDVIVDNLDGVFVSDTSLLQRIGFRRQL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgaagaacacctcgttttgtggcttcctgatacttgttctcgcaacatgtatg
tcagctcaatttgtatcaaatgaaagcataaagctacacgacatattaaaaccgtcagct
actcatcggttattcgatacactgcaatactcagtagaagaacaatattcagattcacat
ctctcttttgatgtatccactatttacaactactccgagaaacccatatctattggaaag
ttgaacaaaaaatacagagacatattgtttgaaggagacatggcgattagttataaacaa
ctgagtatgatagtcaatggatccacagaatatcgaaaagccattaaatcacgtcgtaga
ggcaataaaataaatggagaatcaactgataggacgaaaagacaagcatacttagacaac
aattatccggcaactatctggaagaatggtgttgctttcatgtttcacgagtctctcacg
cccattgcgaaaacagctattttgaaagcagttcatttctggtatcgagaaacttgtatt
gaatttcatccacgaacattccaaaaagagtatctcctttttatcggaaatgacgatggg
tgttggagtacagtgggacgagatgcatcacaaggaaaacaagttgttagtattggaaac
ggatgtgagcatttcggagtcacatctcatgagctggcacacgcattgggaatattccac
gaacaatcaagatttgatcgggatgaatctgtagtgttcaatccaagagtcgttgaaaga
gatcttttattcaattttgcaaaaatatcccctcgtcaaatgtcgacttacggcttgcca
tatgatattgggagcgtaatgcattatactccaactgaattctcaaacatcccttccata
ccaacgttagctgcaatcgacacaaatcttcagcaaacaatgggtcaattggaaggacct
tcttttgtggatgtgcatattatgaatcaacattatcagtgccaagaaaagtgtccaact
caagctccttgccaaaatggtggcttcactaattcccgtaactgcaaagtttgcaaatgt
ccaactggctttggaggggcttactgtcaactcattgcttcatcattttccccattctgt
ggtggctacctaaacgcggaagaaacaactcgaagatttgatatcactattcgccaatcg
acaactacaagatcgaaaacatgtgtttatcacataaaagctccagagggaaaacggatt
ataattgacattctgaaaatagactcgaagtgtattgaaggatgctggcaagatggatta
gagttgaagatgaaaaaggattttaggcccgttgggtatagattttgctgccctgagtca
tctcgtcggaaagtgatatcagaagggaacatggtcccttttatggttttctcaaaagaa
catgatttttcggtttcatttgagtactcttttgtttccaccagcgcaggatttgacgac
gaaaagaatgattcagatgttatcgttgacaatttggatggagtttttgtgtccgacact
tccctacttcaaaggataggatttagaagacagttatag

DBGET integrated database retrieval system