KEGG   Caenorhabditis elegans (nematode): CELE_F59A3.6Help
Entry
CELE_F59A3.6      CDS       T00019                                 

Gene name
rpa-4
Definition
(RefSeq) Replication Protein A homolog
  KO
K10739  replication factor A2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03030  DNA replication
cel03420  Nucleotide excision repair
cel03430  Mismatch repair
cel03440  Homologous recombination
cel03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CELE_F59A3.6 (rpa-4)
   03420 Nucleotide excision repair
    CELE_F59A3.6 (rpa-4)
   03430 Mismatch repair
    CELE_F59A3.6 (rpa-4)
   03440 Homologous recombination
    CELE_F59A3.6 (rpa-4)
   03460 Fanconi anemia pathway
    CELE_F59A3.6 (rpa-4)
DNA replication proteins [BR:cel03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CELE_F59A3.6 (rpa-4)
DNA repair and recombination proteins [BR:cel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CELE_F59A3.6 (rpa-4)
   MMR (mismatch exicision repair)
     CELE_F59A3.6 (rpa-4)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CELE_F59A3.6 (rpa-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RPA_C Cas_TM1802
Motif
Other DBs
NCBI-GeneID: 186576
NCBI-ProteinID: NP_001300389
WormBase: WBGene00019079
Ensembl: WBGene00019079
UniProt: Q8I7G2
Position
I:complement(join(5509576..5509764,5509815..5509904,5509956..5510060,5510103..5510197,5510243..5510276))
Genome map
AA seq 170 aa AA seqDB search
MGKLKNVAGNKMILIYYLQKLADNKEYEIFKLETQASYLFFKKNLIERMRTSKAYKWEGM
LAPPLSRQNHKIDAQAILSPVITRQVKPTTKTQSESISPKTSSALKAKVGAVIRSEAASK
GYGDEEGVPFERILARIKDIPESRLRDILTEMGDSGMIYSARDNEFMSLN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattgaagaatgtcgcaggaaataaaatgattcttatatactaccttcaaaag
ttggctgacaacaaggagtatgaaattttcaagttggagacacaagcttcttatttattc
ttcaaaaagaatttgatcgagcgaatgcgaacttctaaagcttataaatgggaaggaatg
ctggctccgccgttgtcacgacaaaatcataaaattgacgcacaggctattttgagccca
gttatcactagacaagtgaaaccgaccacgaaaacacagtccgaatcaatttcaccaaaa
acttcttcggcattgaaagcgaaggttggcgcagttatccgatcagaagccgccagtaag
ggatacggcgacgaagaaggcgtaccattcgaaagaatcttggctcgcataaaagatatt
ccagagtctcgtcttcgagacattctgacagaaatgggagacagtggaatgatttactcg
gccagagacaatgagttcatgtcgcttaattga

DBGET integrated database retrieval system