KEGG   Caenorhabditis elegans (nematode): CELE_F59A3.6Help
Entry
CELE_F59A3.6      CDS       T00019                                 

Gene name
rpa-4
Definition
(RefSeq) Replication Protein A homolog
  KO
K10739  
replication factor A2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CELE_F59A3.6 (rpa-4)
   03420 Nucleotide excision repair
    CELE_F59A3.6 (rpa-4)
   03430 Mismatch repair
    CELE_F59A3.6 (rpa-4)
   03440 Homologous recombination
    CELE_F59A3.6 (rpa-4)
   03460 Fanconi anemia pathway
    CELE_F59A3.6 (rpa-4)
DNA replication proteins [BR:cel03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CELE_F59A3.6 (rpa-4)
DNA repair and recombination proteins [BR:cel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CELE_F59A3.6 (rpa-4)
   MMR (mismatch exicision repair)
     CELE_F59A3.6 (rpa-4)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CELE_F59A3.6 (rpa-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(5509576..5509764,5509815..5509904,5509956..5510060,5510103..5510197,5510243..5510276))
Genome map
AA seq 170 aa AA seqDB search
MGKLKNVAGNKMILIYYLQKLADNKEYEIFKLETQASYLFFKKNLIERMRTSKAYKWEGM
LAPPLSRQNHKIDAQAILSPVITRQVKPTTKTQSESISPKTSSALKAKVGAVIRSEAASK
GYGDEEGVPFERILARIKDIPESRLRDILTEMGDSGMIYSARDNEFMSLN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattgaagaatgtcgcaggaaataaaatgattcttatatactaccttcaaaag
ttggctgacaacaaggagtatgaaattttcaagttggagacacaagcttcttatttattc
ttcaaaaagaatttgatcgagcgaatgcgaacttctaaagcttataaatgggaaggaatg
ctggctccgccgttgtcacgacaaaatcataaaattgacgcacaggctattttgagccca
gttatcactagacaagtgaaaccgaccacgaaaacacagtccgaatcaatttcaccaaaa
acttcttcggcattgaaagcgaaggttggcgcagttatccgatcagaagccgccagtaag
ggatacggcgacgaagaaggcgtaccattcgaaagaatcttggctcgcataaaagatatt
ccagagtctcgtcttcgagacattctgacagaaatgggagacagtggaatgatttactcg
gccagagacaatgagttcatgtcgcttaattga

DBGET integrated database retrieval system