KEGG   Caenorhabditis elegans (nematode): CELE_F59A3.6Help
Entry
CELE_F59A3.6      CDS       T00019                                 

Gene name
rpa-4
Definition
Protein RPA-4
Orthology
K10739  
replication factor A2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CELE_F59A3.6 (rpa-4)
   03420 Nucleotide excision repair
    CELE_F59A3.6 (rpa-4)
   03430 Mismatch repair
    CELE_F59A3.6 (rpa-4)
   03440 Homologous recombination
    CELE_F59A3.6 (rpa-4)
   03460 Fanconi anemia pathway
    CELE_F59A3.6 (rpa-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(5510454..5510642,5510693..5510782,5510834..5510938,5510981..5511075,5511121..5511211,5511259..5511378,5511429..5511551,5511601..5511669))
Genome map
AA seq 293 aa AA seqDB search
MEFDRNFDTSDGWSSHDISQERKNQSFQSLGDKLPLPVTLASLSTKLEDTDDDSYQIGEY
SFRTIHTVGVILEKSYEDGKTTYTLHDPEDTAKIFHAVQFGNYNDGGSKFVSPGLEEDTR
VRLMGKLKNVAGNKMILIYYLQKLADNKEYEIFKLETQASYLFFKKNLIERMRTSKAYKW
EGMLAPPLSRQNHKIDAQAILSPVITRQVKPTTKTQSESISPKTSSALKAKVGAVIRSEA
ASKGYGDEEGVPFERILARIKDIPESRLRDILTEMGDSGMIYSARDNEFMSLN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgatcgaaattttgacactagcgatggatggtcatcgcatgatatttcacaa
gagagaaagaatcaaagtttccaatctctcggtgacaaattaccgcttccagtgactctt
gcatctttgagcacaaaattggaagatacagacgatgattcatatcaaattggagaatat
agttttcgaacaattcacacagttggcgtaatcttggaaaaatcgtacgaggatgggaag
acaacatatacacttcatgatcctgaagatactgccaagatatttcacgcagttcaattc
ggaaattacaacgatggtggctccaagttcgtctctccgggtttagaggaagacacgcga
gtccgtctgatgggaaaattgaagaatgtcgcaggaaataaaatgattcttatatactac
cttcaaaagttggctgacaacaaggagtatgaaattttcaagttggagacacaagcttct
tatttattcttcaaaaagaatttgatcgagcgaatgcgaacttctaaagcttataaatgg
gaaggaatgctggctccgccgttgtcacgacaaaatcataaaattgacgcacaggctatt
ttgagcccagttatcactagacaagtgaaaccgaccacgaaaacacagtccgaatcaatt
tcaccaaaaacttcttcggcattgaaagcgaaggttggcgcagttatccgatcagaagcc
gccagtaagggatacggcgacgaagaaggcgtaccattcgaaagaatcttggctcgcata
aaagatattccagagtctcgtcttcgagacattctgacagaaatgggagacagtggaatg
atttactcggccagagacaatgagttcatgtcgcttaattga

DBGET integrated database retrieval system